Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JJ31

Protein Details
Accession A0A397JJ31    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
28-51MGLCAACRRRRHERRNRCHKIHIIBasic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 12.666, nucl 8.5, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MIVKFLMAIDFKNYKIISLVINCKCYSMGLCAACRRRRHERRNRCHKIHIIGRCHEDYGYTMTRLDVPGVIFKYRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.18
5 0.21
6 0.3
7 0.28
8 0.31
9 0.31
10 0.3
11 0.29
12 0.26
13 0.22
14 0.16
15 0.17
16 0.16
17 0.19
18 0.24
19 0.31
20 0.36
21 0.39
22 0.42
23 0.49
24 0.57
25 0.66
26 0.72
27 0.76
28 0.82
29 0.89
30 0.92
31 0.86
32 0.84
33 0.78
34 0.76
35 0.72
36 0.69
37 0.64
38 0.58
39 0.58
40 0.52
41 0.46
42 0.38
43 0.3
44 0.24
45 0.24
46 0.22
47 0.18
48 0.17
49 0.17
50 0.19
51 0.19
52 0.18
53 0.13
54 0.12
55 0.18
56 0.2