Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IRT8

Protein Details
Accession A0A397IRT8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-25TKYLPFKKKSVLWRTNNCRSILHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 13, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MNHTKYLPFKKKSVLWRTNNCRSILRTAALLFTIRFFFSHSKCRNTQNNEINLMTGNANSTFLLRIMRIEILINGVRIKVHMKSYDFFLSHQMQCNLMNLSMF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.7
3 0.76
4 0.82
5 0.84
6 0.82
7 0.74
8 0.67
9 0.6
10 0.57
11 0.49
12 0.41
13 0.32
14 0.27
15 0.25
16 0.22
17 0.2
18 0.14
19 0.11
20 0.11
21 0.09
22 0.09
23 0.11
24 0.14
25 0.17
26 0.27
27 0.3
28 0.34
29 0.37
30 0.45
31 0.5
32 0.53
33 0.59
34 0.57
35 0.57
36 0.54
37 0.51
38 0.43
39 0.35
40 0.29
41 0.2
42 0.12
43 0.09
44 0.06
45 0.07
46 0.06
47 0.07
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.1
59 0.11
60 0.11
61 0.1
62 0.1
63 0.1
64 0.1
65 0.13
66 0.12
67 0.16
68 0.2
69 0.23
70 0.24
71 0.3
72 0.34
73 0.33
74 0.31
75 0.32
76 0.34
77 0.33
78 0.39
79 0.35
80 0.31
81 0.31
82 0.34
83 0.3