Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1X3Y5

Protein Details
Accession K1X3Y5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
172-208FYVYLLRARIRRRRRRRRRRMRRRSARRGGRRGEPAPBasic
NLS Segment(s)
PositionSequence
178-208RARIRRRRRRRRRRMRRRSARRGGRRGEPAP
Subcellular Location(s) extr 6, mito 5, cyto 5, plas 5, cyto_mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mbe:MBM_01888  -  
Pfam View protein in Pfam  
PF05808  Podoplanin  
Amino Acid Sequences MAPRNPRRGHENGAEEMVESGCCLVAAGGATTATTTSTITWSLPEERSGRKKVAAGMMRTRMDEWEIQRRNDADEEDRDGDYYISVVRSAHVSATTIPLGDDFPTAAAAAAAAAYPSSRFSTSMNPPTTNPITAKVVTATATDVQTPGIPTGTIVGIVVGVSLGILLLLGVFYVYLLRARIRRRRRRRRRRMRRRSARRGGRRGEPAPPVPPPAEGVFPPANP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.39
3 0.33
4 0.26
5 0.17
6 0.11
7 0.08
8 0.06
9 0.06
10 0.05
11 0.04
12 0.04
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.06
19 0.06
20 0.05
21 0.05
22 0.06
23 0.06
24 0.08
25 0.09
26 0.09
27 0.1
28 0.12
29 0.16
30 0.17
31 0.2
32 0.22
33 0.29
34 0.36
35 0.4
36 0.39
37 0.38
38 0.39
39 0.39
40 0.45
41 0.43
42 0.4
43 0.43
44 0.48
45 0.46
46 0.44
47 0.4
48 0.32
49 0.29
50 0.28
51 0.25
52 0.29
53 0.32
54 0.32
55 0.34
56 0.34
57 0.34
58 0.32
59 0.3
60 0.23
61 0.22
62 0.26
63 0.25
64 0.24
65 0.22
66 0.21
67 0.18
68 0.14
69 0.12
70 0.07
71 0.05
72 0.06
73 0.05
74 0.05
75 0.06
76 0.07
77 0.07
78 0.06
79 0.07
80 0.07
81 0.09
82 0.09
83 0.08
84 0.08
85 0.07
86 0.08
87 0.07
88 0.07
89 0.05
90 0.05
91 0.05
92 0.05
93 0.04
94 0.04
95 0.03
96 0.03
97 0.03
98 0.02
99 0.02
100 0.02
101 0.02
102 0.03
103 0.04
104 0.05
105 0.06
106 0.07
107 0.08
108 0.15
109 0.21
110 0.29
111 0.3
112 0.3
113 0.3
114 0.36
115 0.36
116 0.31
117 0.26
118 0.21
119 0.21
120 0.2
121 0.2
122 0.15
123 0.14
124 0.13
125 0.12
126 0.11
127 0.1
128 0.1
129 0.09
130 0.09
131 0.09
132 0.09
133 0.09
134 0.08
135 0.07
136 0.06
137 0.06
138 0.07
139 0.07
140 0.06
141 0.05
142 0.05
143 0.04
144 0.04
145 0.04
146 0.03
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.01
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.03
162 0.04
163 0.06
164 0.09
165 0.15
166 0.24
167 0.34
168 0.46
169 0.57
170 0.67
171 0.78
172 0.86
173 0.92
174 0.95
175 0.97
176 0.97
177 0.98
178 0.98
179 0.98
180 0.98
181 0.98
182 0.97
183 0.97
184 0.96
185 0.96
186 0.94
187 0.89
188 0.87
189 0.85
190 0.77
191 0.73
192 0.69
193 0.62
194 0.57
195 0.53
196 0.49
197 0.41
198 0.38
199 0.34
200 0.29
201 0.28
202 0.23
203 0.27