Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397H5B2

Protein Details
Accession A0A397H5B2    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-35RKYNNEKIKAVKKKREKKNVLDEEFQHydrophilic
NLS Segment(s)
PositionSequence
10-27RKYNNEKIKAVKKKREKK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPKRKYPMLRKYNNEKIKAVKKKREKKNVLDEEFQEESDEQDNDQEENKEIDEEEKIRTRLLATTLVLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.71
3 0.69
4 0.71
5 0.72
6 0.72
7 0.71
8 0.74
9 0.8
10 0.87
11 0.89
12 0.87
13 0.85
14 0.87
15 0.87
16 0.81
17 0.74
18 0.64
19 0.59
20 0.51
21 0.42
22 0.31
23 0.21
24 0.17
25 0.15
26 0.14
27 0.08
28 0.09
29 0.09
30 0.09
31 0.11
32 0.11
33 0.1
34 0.11
35 0.12
36 0.11
37 0.1
38 0.11
39 0.13
40 0.13
41 0.17
42 0.22
43 0.22
44 0.22
45 0.22
46 0.22
47 0.22
48 0.24
49 0.24
50 0.19