Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397I7U5

Protein Details
Accession A0A397I7U5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
31-63NRCKGLKRICVKKFQKKRGRKKKQNENEQNDIDHydrophilic
NLS Segment(s)
PositionSequence
42-53KKFQKKRGRKKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
Amino Acid Sequences MTKRPNYTENACTGCANAKKKCERELADICNRCKGLKRICVKKFQKKRGRKKKQNENEQNDIDTFYVDYVFSETEAPISSILNYGNLWHEHKSAGNHFLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.39
4 0.38
5 0.43
6 0.5
7 0.54
8 0.6
9 0.61
10 0.59
11 0.6
12 0.63
13 0.62
14 0.63
15 0.65
16 0.6
17 0.56
18 0.52
19 0.44
20 0.42
21 0.41
22 0.4
23 0.42
24 0.5
25 0.55
26 0.6
27 0.7
28 0.73
29 0.76
30 0.78
31 0.8
32 0.82
33 0.82
34 0.89
35 0.9
36 0.92
37 0.92
38 0.92
39 0.93
40 0.93
41 0.93
42 0.93
43 0.89
44 0.84
45 0.75
46 0.66
47 0.55
48 0.46
49 0.34
50 0.23
51 0.16
52 0.08
53 0.07
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.07
60 0.07
61 0.07
62 0.08
63 0.08
64 0.07
65 0.08
66 0.07
67 0.08
68 0.08
69 0.09
70 0.08
71 0.09
72 0.13
73 0.15
74 0.18
75 0.19
76 0.2
77 0.2
78 0.24
79 0.29
80 0.3