Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397H5K0

Protein Details
Accession A0A397H5K0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-92GDNKNNRMSKRARKTRKKGPKPGLSSLKGNHydrophilic
NLS Segment(s)
PositionSequence
69-86RMSKRARKTRKKGPKPGL
Subcellular Location(s) nucl 15.5, cyto_nucl 13.833, cyto 7, cyto_pero 4.665
Family & Domain DBs
Amino Acid Sequences MIYQNNIRQYILDNLDDMEILINEKHINENDNDDEKINENKKIFLHKNDDGDDDDDDYDDGDGDNKNNRMSKRARKTRKKGPKPGLSSLKGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.2
4 0.17
5 0.1
6 0.07
7 0.07
8 0.06
9 0.06
10 0.07
11 0.07
12 0.1
13 0.1
14 0.12
15 0.12
16 0.16
17 0.19
18 0.22
19 0.22
20 0.2
21 0.2
22 0.2
23 0.26
24 0.24
25 0.24
26 0.22
27 0.23
28 0.24
29 0.32
30 0.33
31 0.31
32 0.36
33 0.35
34 0.38
35 0.37
36 0.37
37 0.31
38 0.29
39 0.24
40 0.18
41 0.15
42 0.11
43 0.1
44 0.08
45 0.07
46 0.05
47 0.05
48 0.05
49 0.06
50 0.07
51 0.12
52 0.13
53 0.17
54 0.21
55 0.22
56 0.28
57 0.37
58 0.46
59 0.53
60 0.63
61 0.71
62 0.77
63 0.86
64 0.91
65 0.93
66 0.93
67 0.93
68 0.93
69 0.92
70 0.88
71 0.89
72 0.88