Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GCR3

Protein Details
Accession A0A397GCR3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
33-60QNRKEICTFKPQKKRGPKPKRVEFPSVEHydrophilic
NLS Segment(s)
PositionSequence
43-53PQKKRGPKPKR
Subcellular Location(s) mito 19.5, mito_nucl 13.333, nucl 6, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
Amino Acid Sequences MPRKHSAHACTCCAMAKRRCISMPSETKCVRCQNRKEICTFKPQKKRGPKPKRVEFPSVETFSFNLNYKFLPDEAPISFEFQYEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.45
4 0.45
5 0.48
6 0.49
7 0.46
8 0.46
9 0.47
10 0.5
11 0.45
12 0.49
13 0.47
14 0.47
15 0.51
16 0.56
17 0.55
18 0.54
19 0.57
20 0.6
21 0.67
22 0.67
23 0.67
24 0.65
25 0.58
26 0.6
27 0.61
28 0.59
29 0.6
30 0.63
31 0.67
32 0.72
33 0.8
34 0.81
35 0.84
36 0.85
37 0.86
38 0.9
39 0.9
40 0.85
41 0.82
42 0.73
43 0.69
44 0.66
45 0.58
46 0.49
47 0.4
48 0.34
49 0.29
50 0.28
51 0.23
52 0.17
53 0.15
54 0.15
55 0.15
56 0.17
57 0.16
58 0.16
59 0.16
60 0.18
61 0.17
62 0.2
63 0.19
64 0.21
65 0.21