Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J114

Protein Details
Accession A0A397J114    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
50-70GKSPKRRKTSRSHVPSPGRAPBasic
NLS Segment(s)
PositionSequence
51-61KSPKRRKTSRS
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MHIAWGVAIAQLFLNPDRKLQQKRSLRPEEGELDAEETSEEESKEEEEEGKSPKRRKTSRSHVPSPGRAPSTGRVSPXF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.17
4 0.21
5 0.3
6 0.37
7 0.43
8 0.51
9 0.56
10 0.65
11 0.72
12 0.76
13 0.7
14 0.65
15 0.61
16 0.54
17 0.46
18 0.38
19 0.28
20 0.22
21 0.18
22 0.16
23 0.12
24 0.08
25 0.07
26 0.07
27 0.06
28 0.05
29 0.05
30 0.06
31 0.06
32 0.07
33 0.07
34 0.07
35 0.1
36 0.14
37 0.21
38 0.27
39 0.33
40 0.39
41 0.48
42 0.54
43 0.59
44 0.66
45 0.7
46 0.74
47 0.78
48 0.79
49 0.79
50 0.8
51 0.8
52 0.75
53 0.71
54 0.63
55 0.55
56 0.51
57 0.48
58 0.48