Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HJY5

Protein Details
Accession A0A397HJY5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
73-105NHNVGKHSKGSKKRKAKKAKKAQKANESKASKEBasic
NLS Segment(s)
PositionSequence
79-105KHSKGSKKRKAKKAKKAQKANESKASK
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF12874  zf-met  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MIXRLQSTIYKRKKFSKIDEVAILSHVNAKHTFSNNNNHHHNVNMAENTGKEKRLAYYCKPCNKVFLREFDLNNHNVGKHSKGSKKRKAKKAKKAQKANESKASKESVESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.73
4 0.71
5 0.69
6 0.61
7 0.52
8 0.45
9 0.36
10 0.25
11 0.22
12 0.18
13 0.15
14 0.14
15 0.16
16 0.19
17 0.22
18 0.27
19 0.27
20 0.37
21 0.4
22 0.46
23 0.48
24 0.46
25 0.44
26 0.39
27 0.36
28 0.28
29 0.25
30 0.19
31 0.15
32 0.13
33 0.13
34 0.17
35 0.17
36 0.15
37 0.13
38 0.13
39 0.15
40 0.2
41 0.24
42 0.26
43 0.35
44 0.42
45 0.49
46 0.53
47 0.51
48 0.53
49 0.52
50 0.55
51 0.48
52 0.46
53 0.45
54 0.45
55 0.45
56 0.42
57 0.42
58 0.35
59 0.33
60 0.28
61 0.22
62 0.2
63 0.21
64 0.19
65 0.21
66 0.27
67 0.34
68 0.44
69 0.54
70 0.63
71 0.72
72 0.8
73 0.85
74 0.89
75 0.91
76 0.92
77 0.93
78 0.93
79 0.93
80 0.94
81 0.93
82 0.92
83 0.92
84 0.89
85 0.88
86 0.81
87 0.73
88 0.67
89 0.61
90 0.5