Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397INS6

Protein Details
Accession A0A397INS6    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
15-62ASTSNLSRKRGRPKKEKVSTASASTTTTPPPPRKRGRPRKIQKSDDIPHydrophilic
NLS Segment(s)
PositionSequence
22-32RKRGRPKKEKV
43-58PPPPRKRGRPRKIQKS
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, mito_nucl 11.666, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MNNMNNSSTSTIEIASTSNLSRKRGRPKKEKVSTASASTTTTPPPPRKRGRPRKIQKSDDIPDFKKIAKIKEYIKKHVPSVTNDTEDNVSEKSKKMAQELWDKVNNYEKKYLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.11
5 0.16
6 0.19
7 0.23
8 0.3
9 0.37
10 0.47
11 0.55
12 0.64
13 0.69
14 0.77
15 0.84
16 0.86
17 0.86
18 0.8
19 0.79
20 0.72
21 0.65
22 0.56
23 0.45
24 0.37
25 0.31
26 0.26
27 0.19
28 0.21
29 0.24
30 0.31
31 0.38
32 0.46
33 0.53
34 0.62
35 0.72
36 0.79
37 0.82
38 0.84
39 0.87
40 0.9
41 0.91
42 0.86
43 0.8
44 0.77
45 0.72
46 0.68
47 0.63
48 0.53
49 0.47
50 0.43
51 0.37
52 0.33
53 0.31
54 0.28
55 0.27
56 0.3
57 0.34
58 0.42
59 0.47
60 0.49
61 0.55
62 0.54
63 0.52
64 0.54
65 0.5
66 0.46
67 0.48
68 0.46
69 0.41
70 0.38
71 0.37
72 0.32
73 0.29
74 0.25
75 0.18
76 0.16
77 0.15
78 0.16
79 0.19
80 0.21
81 0.23
82 0.26
83 0.3
84 0.34
85 0.43
86 0.47
87 0.51
88 0.53
89 0.52
90 0.5
91 0.55
92 0.53
93 0.47