Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GN47

Protein Details
Accession A0A397GN47    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MTKKHKHLRQRKKKTTFKKEKNEVTKTEKSBasic
100-122VNYPKELKKSQLKKKKEELKDVIHydrophilic
NLS Segment(s)
PositionSequence
3-23KKHKHLRQRKKKTTFKKEKNE
111-115LKKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000195  Rab-GAP-TBC_dom  
IPR035969  Rab-GAP_TBC_sf  
IPR045913  TBC20/Gyp8-like  
Gene Ontology GO:0005096  F:GTPase activator activity  
GO:0043547  P:positive regulation of GTPase activity  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF00566  RabGAP-TBC  
PROSITE View protein in PROSITE  
PS50086  TBC_RABGAP  
Amino Acid Sequences MTKKHKHLRQRKKKTTFKKEKNEVTKTEKSTKKTINKACEENDLKSLRKLACSEGFLSNSLRSSCWANLLKVGKISRENKIEENHKDEDQVLLDVERSFVNYPKELKKSQLKKKKEELKDVIIGILRRNPKLSYYQGFHDISFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.96
3 0.95
4 0.95
5 0.94
6 0.93
7 0.93
8 0.93
9 0.88
10 0.84
11 0.81
12 0.78
13 0.74
14 0.73
15 0.69
16 0.63
17 0.65
18 0.67
19 0.68
20 0.69
21 0.71
22 0.71
23 0.71
24 0.72
25 0.65
26 0.65
27 0.59
28 0.51
29 0.5
30 0.43
31 0.38
32 0.34
33 0.37
34 0.28
35 0.27
36 0.27
37 0.25
38 0.25
39 0.26
40 0.27
41 0.24
42 0.24
43 0.23
44 0.23
45 0.19
46 0.17
47 0.16
48 0.13
49 0.12
50 0.14
51 0.13
52 0.18
53 0.19
54 0.17
55 0.22
56 0.23
57 0.23
58 0.23
59 0.23
60 0.19
61 0.24
62 0.26
63 0.27
64 0.29
65 0.3
66 0.31
67 0.35
68 0.4
69 0.37
70 0.4
71 0.37
72 0.33
73 0.32
74 0.29
75 0.25
76 0.19
77 0.16
78 0.1
79 0.08
80 0.08
81 0.07
82 0.08
83 0.07
84 0.08
85 0.08
86 0.11
87 0.14
88 0.16
89 0.21
90 0.27
91 0.32
92 0.32
93 0.39
94 0.46
95 0.53
96 0.62
97 0.67
98 0.69
99 0.72
100 0.81
101 0.84
102 0.82
103 0.83
104 0.79
105 0.75
106 0.72
107 0.63
108 0.55
109 0.48
110 0.4
111 0.32
112 0.32
113 0.29
114 0.27
115 0.29
116 0.28
117 0.28
118 0.34
119 0.39
120 0.4
121 0.39
122 0.42
123 0.47
124 0.47