Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JVW1

Protein Details
Accession A0A397JVW1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPRKRKNTRLLWKYNDKKRKGKVREEFEEQIBasic
NLS Segment(s)
PositionSequence
3-22RKRKNTRLLWKYNDKKRKGK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MPRKRKNTRLLWKYNDKKRKGKVREEFEEQILEDNEFDDQEKENEEDSEEENRYDFFTLAKASNWACNEQEDVVYDTEFVQIEGKDELSFASTSSSKISAEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.85
4 0.84
5 0.84
6 0.86
7 0.84
8 0.84
9 0.84
10 0.83
11 0.82
12 0.8
13 0.73
14 0.64
15 0.56
16 0.45
17 0.37
18 0.28
19 0.22
20 0.14
21 0.11
22 0.09
23 0.08
24 0.09
25 0.07
26 0.07
27 0.07
28 0.09
29 0.09
30 0.1
31 0.1
32 0.1
33 0.1
34 0.11
35 0.14
36 0.13
37 0.12
38 0.11
39 0.12
40 0.11
41 0.11
42 0.09
43 0.06
44 0.06
45 0.08
46 0.09
47 0.09
48 0.11
49 0.11
50 0.15
51 0.16
52 0.17
53 0.16
54 0.16
55 0.17
56 0.16
57 0.16
58 0.13
59 0.14
60 0.13
61 0.12
62 0.11
63 0.1
64 0.11
65 0.11
66 0.09
67 0.09
68 0.08
69 0.1
70 0.11
71 0.11
72 0.09
73 0.09
74 0.09
75 0.1
76 0.1
77 0.08
78 0.12
79 0.11
80 0.13
81 0.15
82 0.16