Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IZY6

Protein Details
Accession A0A397IZY6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
84-107VEFLLNKLYKKKKKENSNMNNMLPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 12, cyto 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002872  Proline_DH_dom  
Pfam View protein in Pfam  
PF01619  Pro_dh  
Amino Acid Sequences MKDLPLHHRKIHVPQFLLSTDKEDIKDFEYLTNRLEKKIAKRKTMEKDEEKEKWEEDGWPKKYGWLSPVHDNIEDTHKSYNEAVEFLLNKLYKKKKKENSNMNNMLPLFIASQNRESDEPIWN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.47
4 0.44
5 0.34
6 0.29
7 0.24
8 0.24
9 0.23
10 0.21
11 0.21
12 0.2
13 0.22
14 0.18
15 0.21
16 0.22
17 0.22
18 0.22
19 0.29
20 0.27
21 0.26
22 0.29
23 0.29
24 0.36
25 0.45
26 0.5
27 0.49
28 0.54
29 0.62
30 0.69
31 0.74
32 0.72
33 0.69
34 0.68
35 0.68
36 0.66
37 0.59
38 0.51
39 0.42
40 0.35
41 0.28
42 0.26
43 0.26
44 0.32
45 0.32
46 0.33
47 0.32
48 0.33
49 0.33
50 0.3
51 0.26
52 0.23
53 0.24
54 0.27
55 0.31
56 0.3
57 0.29
58 0.29
59 0.27
60 0.26
61 0.23
62 0.19
63 0.17
64 0.16
65 0.17
66 0.17
67 0.18
68 0.13
69 0.13
70 0.12
71 0.12
72 0.13
73 0.12
74 0.17
75 0.15
76 0.16
77 0.24
78 0.34
79 0.39
80 0.47
81 0.58
82 0.62
83 0.73
84 0.82
85 0.85
86 0.85
87 0.89
88 0.87
89 0.78
90 0.74
91 0.62
92 0.52
93 0.41
94 0.31
95 0.22
96 0.18
97 0.21
98 0.19
99 0.23
100 0.24
101 0.27
102 0.27
103 0.28