Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JAR9

Protein Details
Accession A0A397JAR9    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
69-99QSNEKFTPKKCDIKKKYTKKIRYQKIYTSCDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MLGDYTCYYIHNSGEVCGRGCRRPEGCFDHWKSKKRFPCKVCGKPTSSEPGLCRAHVKGYYVMKCLYGQSNEKFTPKKCDIKKKYTKKIRYQKIYTSCD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.2
4 0.23
5 0.26
6 0.28
7 0.3
8 0.36
9 0.34
10 0.35
11 0.41
12 0.44
13 0.46
14 0.51
15 0.54
16 0.58
17 0.62
18 0.68
19 0.67
20 0.68
21 0.71
22 0.71
23 0.75
24 0.68
25 0.72
26 0.74
27 0.77
28 0.76
29 0.73
30 0.67
31 0.6
32 0.58
33 0.54
34 0.44
35 0.37
36 0.29
37 0.31
38 0.28
39 0.26
40 0.25
41 0.19
42 0.21
43 0.2
44 0.21
45 0.19
46 0.25
47 0.27
48 0.27
49 0.27
50 0.25
51 0.24
52 0.24
53 0.22
54 0.19
55 0.22
56 0.24
57 0.3
58 0.31
59 0.35
60 0.38
61 0.36
62 0.42
63 0.44
64 0.5
65 0.53
66 0.63
67 0.67
68 0.74
69 0.83
70 0.84
71 0.89
72 0.9
73 0.91
74 0.91
75 0.93
76 0.93
77 0.92
78 0.88
79 0.87