Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J8K7

Protein Details
Accession A0A397J8K7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-33VNVPKTRNTYCKGKNCKKHTPHKVSQYKKGKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRNTYCKGKNCKKHTPHKVSQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECQSCKYKHQVAIKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.82
4 0.87
5 0.87
6 0.88
7 0.89
8 0.88
9 0.86
10 0.87
11 0.89
12 0.85
13 0.85
14 0.85
15 0.8
16 0.74
17 0.71
18 0.61
19 0.56
20 0.54
21 0.53
22 0.53
23 0.53
24 0.54
25 0.55
26 0.58
27 0.58
28 0.6
29 0.58
30 0.57
31 0.6
32 0.61
33 0.61
34 0.61
35 0.61
36 0.59
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.62
58 0.62
59 0.63
60 0.58
61 0.53
62 0.52
63 0.47
64 0.45
65 0.47
66 0.47
67 0.46
68 0.53
69 0.59
70 0.62
71 0.71
72 0.74
73 0.76
74 0.72
75 0.68
76 0.61
77 0.54
78 0.52
79 0.51
80 0.52
81 0.51
82 0.54
83 0.51
84 0.49
85 0.48
86 0.42