Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JL24

Protein Details
Accession A0A397JL24    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
87-106ISNKVLKKVNPKIKIKRPDYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR001611  Leu-rich_rpt  
IPR006553  Leu-rich_rpt_Cys-con_subtyp  
IPR032675  LRR_dom_sf  
Pfam View protein in Pfam  
PF13516  LRR_6  
Amino Acid Sequences MVYLRLEGLKISDALIKIARYCPKLLHLSLNSCICFTNRCITEITRSCPKLKYLELGDCSIGNEAIKKIANNCTNLKYLSLKWCRRISNKVLKKVNPKIKIKRPDYSDNEFSDSDLPSLIPIFTGRRNRIAITNPLETII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.17
4 0.17
5 0.23
6 0.28
7 0.27
8 0.28
9 0.28
10 0.31
11 0.36
12 0.36
13 0.38
14 0.37
15 0.38
16 0.42
17 0.44
18 0.38
19 0.33
20 0.31
21 0.24
22 0.22
23 0.2
24 0.23
25 0.2
26 0.21
27 0.23
28 0.24
29 0.32
30 0.34
31 0.37
32 0.37
33 0.38
34 0.39
35 0.39
36 0.4
37 0.35
38 0.33
39 0.33
40 0.28
41 0.31
42 0.31
43 0.3
44 0.28
45 0.23
46 0.22
47 0.18
48 0.14
49 0.08
50 0.07
51 0.06
52 0.07
53 0.08
54 0.08
55 0.1
56 0.17
57 0.2
58 0.22
59 0.25
60 0.25
61 0.27
62 0.27
63 0.26
64 0.21
65 0.21
66 0.27
67 0.34
68 0.35
69 0.4
70 0.46
71 0.5
72 0.52
73 0.58
74 0.57
75 0.59
76 0.63
77 0.66
78 0.67
79 0.68
80 0.73
81 0.76
82 0.76
83 0.74
84 0.75
85 0.76
86 0.79
87 0.83
88 0.79
89 0.76
90 0.73
91 0.74
92 0.72
93 0.7
94 0.66
95 0.58
96 0.56
97 0.49
98 0.43
99 0.35
100 0.29
101 0.21
102 0.16
103 0.13
104 0.09
105 0.1
106 0.09
107 0.07
108 0.08
109 0.11
110 0.18
111 0.27
112 0.3
113 0.36
114 0.38
115 0.4
116 0.44
117 0.47
118 0.48
119 0.45
120 0.46