Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1WLC9

Protein Details
Accession K1WLC9    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
134-175RENGSGKPRRDRNRERDRDVDRKRNRERNRQRDRERDRDEYPBasic
193-220REESERHQQRHSRERRKRYPNTDPELVDBasic
NLS Segment(s)
PositionSequence
125-182RSGPSSRGSRENGSGKPRRDRNRERDRDVDRKRNRERNRQRDRERDRDEYPERRRTKA
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
KEGG mbe:MBM_03518  -  
Amino Acid Sequences MSKIAFTIVLPHDSKENNRTPGFYISTSNLTYLNVKGSDFKAARWGNGNTSSGWKSRFEYGVTASKGATKLSLIMNTSVILPPVSWALPIMGEGPPPKQKDEDGKNKGASKTLKASSASEHPPYRSGPSSRGSRENGSGKPRRDRNRERDRDVDRKRNRERNRQRDRERDRDEYPERRRTKAPGETVRWITDREESERHQQRHSRERRKRYPNTDPELVDLGDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.42
4 0.43
5 0.44
6 0.45
7 0.44
8 0.46
9 0.45
10 0.38
11 0.34
12 0.29
13 0.32
14 0.3
15 0.28
16 0.22
17 0.2
18 0.2
19 0.18
20 0.19
21 0.15
22 0.15
23 0.18
24 0.18
25 0.26
26 0.24
27 0.24
28 0.3
29 0.3
30 0.31
31 0.33
32 0.34
33 0.3
34 0.33
35 0.34
36 0.25
37 0.3
38 0.31
39 0.28
40 0.28
41 0.25
42 0.24
43 0.27
44 0.28
45 0.24
46 0.24
47 0.25
48 0.31
49 0.3
50 0.28
51 0.24
52 0.25
53 0.24
54 0.21
55 0.18
56 0.1
57 0.11
58 0.12
59 0.14
60 0.12
61 0.13
62 0.13
63 0.13
64 0.14
65 0.11
66 0.1
67 0.08
68 0.07
69 0.06
70 0.07
71 0.07
72 0.06
73 0.06
74 0.05
75 0.05
76 0.06
77 0.07
78 0.06
79 0.07
80 0.08
81 0.1
82 0.16
83 0.17
84 0.18
85 0.18
86 0.2
87 0.27
88 0.35
89 0.43
90 0.44
91 0.46
92 0.48
93 0.51
94 0.49
95 0.45
96 0.38
97 0.31
98 0.3
99 0.28
100 0.27
101 0.25
102 0.25
103 0.22
104 0.25
105 0.25
106 0.24
107 0.24
108 0.22
109 0.23
110 0.23
111 0.25
112 0.24
113 0.22
114 0.22
115 0.25
116 0.31
117 0.32
118 0.36
119 0.35
120 0.34
121 0.38
122 0.39
123 0.39
124 0.42
125 0.45
126 0.45
127 0.51
128 0.57
129 0.61
130 0.66
131 0.72
132 0.74
133 0.79
134 0.83
135 0.81
136 0.81
137 0.79
138 0.8
139 0.78
140 0.78
141 0.76
142 0.77
143 0.81
144 0.82
145 0.84
146 0.84
147 0.87
148 0.87
149 0.9
150 0.9
151 0.9
152 0.9
153 0.9
154 0.9
155 0.86
156 0.81
157 0.73
158 0.72
159 0.7
160 0.69
161 0.69
162 0.68
163 0.64
164 0.62
165 0.62
166 0.59
167 0.6
168 0.59
169 0.6
170 0.6
171 0.62
172 0.65
173 0.65
174 0.63
175 0.55
176 0.48
177 0.4
178 0.36
179 0.34
180 0.32
181 0.33
182 0.34
183 0.43
184 0.51
185 0.52
186 0.54
187 0.57
188 0.6
189 0.67
190 0.74
191 0.75
192 0.75
193 0.84
194 0.87
195 0.92
196 0.93
197 0.92
198 0.92
199 0.91
200 0.89
201 0.85
202 0.76
203 0.69
204 0.61