Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IYM8

Protein Details
Accession A0A397IYM8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MHYGYEKKSIKRIRTKQCSGIKITHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR001440  TPR_1  
IPR019734  TPR_repeat  
Pfam View protein in Pfam  
PF00515  TPR_1  
PF13181  TPR_8  
PROSITE View protein in PROSITE  
PS50005  TPR  
Amino Acid Sequences MHYGYEKKSIKRIRTKQCSGIKITRRNLSKVKKYNEALRDFNKLLKLEPNNILVLRLRGEIYQKLEKYDETLTDFDKVLKLEPNNIPVLRLRGEIYQKLEKHNESLMDFDKVLEKEPNNALTLRLRENSFKILKKYKEALDDFNKILKINPNDISVLNLIIETEKAKTKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.84
4 0.85
5 0.81
6 0.78
7 0.77
8 0.75
9 0.74
10 0.74
11 0.72
12 0.68
13 0.68
14 0.69
15 0.7
16 0.71
17 0.71
18 0.7
19 0.71
20 0.71
21 0.73
22 0.72
23 0.68
24 0.63
25 0.57
26 0.58
27 0.5
28 0.49
29 0.44
30 0.37
31 0.32
32 0.33
33 0.33
34 0.31
35 0.33
36 0.32
37 0.29
38 0.29
39 0.28
40 0.21
41 0.19
42 0.15
43 0.13
44 0.12
45 0.11
46 0.14
47 0.16
48 0.2
49 0.25
50 0.24
51 0.25
52 0.26
53 0.25
54 0.25
55 0.23
56 0.19
57 0.16
58 0.17
59 0.15
60 0.16
61 0.16
62 0.14
63 0.14
64 0.12
65 0.1
66 0.13
67 0.12
68 0.17
69 0.18
70 0.2
71 0.21
72 0.21
73 0.21
74 0.18
75 0.2
76 0.15
77 0.14
78 0.13
79 0.14
80 0.17
81 0.19
82 0.24
83 0.28
84 0.28
85 0.31
86 0.34
87 0.31
88 0.3
89 0.29
90 0.26
91 0.2
92 0.22
93 0.19
94 0.17
95 0.17
96 0.15
97 0.17
98 0.15
99 0.17
100 0.18
101 0.17
102 0.19
103 0.22
104 0.24
105 0.21
106 0.21
107 0.21
108 0.21
109 0.23
110 0.23
111 0.23
112 0.23
113 0.25
114 0.27
115 0.33
116 0.35
117 0.36
118 0.4
119 0.46
120 0.48
121 0.52
122 0.55
123 0.52
124 0.55
125 0.53
126 0.54
127 0.52
128 0.53
129 0.48
130 0.46
131 0.42
132 0.34
133 0.34
134 0.35
135 0.32
136 0.34
137 0.35
138 0.33
139 0.34
140 0.34
141 0.34
142 0.26
143 0.22
144 0.16
145 0.13
146 0.11
147 0.1
148 0.1
149 0.09
150 0.1