Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397HRW9

Protein Details
Accession A0A397HRW9    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-47LDAQRKRKSKSYETPDQQNERLSRDRERKHEKRTRLADNSHydrophilic
NLS Segment(s)
PositionSequence
33-50RERKHEKRTRLADNSGRK
Subcellular Location(s) nucl 23, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MNNQNSSLDAQRKRKSKSYETPDQQNERLSRDRERKHEKRTRLADNSGRKRQRQEQESNETRQDNRQDQISNRNELDTINRQQNNNIDLQRLGQPQSNTTTLDELDRIVLRQFRVKMDKLKFNLCPLCNESFPSITIVKGEC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.73
4 0.75
5 0.75
6 0.78
7 0.77
8 0.81
9 0.8
10 0.78
11 0.7
12 0.66
13 0.59
14 0.54
15 0.54
16 0.47
17 0.48
18 0.52
19 0.56
20 0.59
21 0.68
22 0.71
23 0.75
24 0.81
25 0.79
26 0.8
27 0.81
28 0.8
29 0.75
30 0.74
31 0.72
32 0.73
33 0.74
34 0.74
35 0.72
36 0.66
37 0.66
38 0.68
39 0.69
40 0.66
41 0.66
42 0.64
43 0.68
44 0.7
45 0.67
46 0.61
47 0.53
48 0.46
49 0.42
50 0.4
51 0.33
52 0.29
53 0.28
54 0.27
55 0.27
56 0.36
57 0.34
58 0.32
59 0.29
60 0.28
61 0.25
62 0.23
63 0.25
64 0.21
65 0.22
66 0.26
67 0.28
68 0.28
69 0.31
70 0.34
71 0.31
72 0.3
73 0.27
74 0.21
75 0.19
76 0.2
77 0.23
78 0.21
79 0.21
80 0.2
81 0.19
82 0.2
83 0.24
84 0.24
85 0.2
86 0.19
87 0.19
88 0.16
89 0.17
90 0.15
91 0.11
92 0.12
93 0.11
94 0.11
95 0.12
96 0.15
97 0.15
98 0.21
99 0.23
100 0.27
101 0.33
102 0.37
103 0.44
104 0.48
105 0.56
106 0.54
107 0.59
108 0.55
109 0.57
110 0.6
111 0.52
112 0.51
113 0.47
114 0.48
115 0.42
116 0.42
117 0.37
118 0.3
119 0.3
120 0.28
121 0.24
122 0.19