Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GEB7

Protein Details
Accession A0A397GEB7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
23-44GTSSKNPPAKKQKSGKKGESSTHydrophilic
NLS Segment(s)
PositionSequence
29-39PPAKKQKSGKK
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MKPAQLKKTAVLPSKHAISSEEGTSSKNPPAKKQKSGKKGESSTVKKLIEELTVEITPSTNISLPPPSQATTSDSIDFTHLYQEIINAESLNDSASQNMIRSYYNFGKGLVDRLNHYKKSNRERASLILVNNEVREQLPEDITDNTLYKKRERARKIYELFDNIGVSRISYVKSFSAITISKLSWDEIDYIIIACTAPRSRDLTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.41
4 0.35
5 0.32
6 0.32
7 0.28
8 0.25
9 0.21
10 0.23
11 0.25
12 0.26
13 0.26
14 0.28
15 0.29
16 0.36
17 0.47
18 0.52
19 0.6
20 0.67
21 0.71
22 0.78
23 0.85
24 0.84
25 0.83
26 0.79
27 0.77
28 0.77
29 0.73
30 0.7
31 0.68
32 0.59
33 0.49
34 0.47
35 0.41
36 0.32
37 0.27
38 0.21
39 0.17
40 0.17
41 0.17
42 0.15
43 0.13
44 0.11
45 0.1
46 0.1
47 0.07
48 0.07
49 0.09
50 0.12
51 0.12
52 0.15
53 0.16
54 0.16
55 0.16
56 0.17
57 0.19
58 0.19
59 0.21
60 0.19
61 0.18
62 0.17
63 0.18
64 0.16
65 0.13
66 0.11
67 0.1
68 0.09
69 0.08
70 0.08
71 0.08
72 0.08
73 0.08
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.06
80 0.05
81 0.05
82 0.06
83 0.06
84 0.06
85 0.07
86 0.07
87 0.06
88 0.07
89 0.13
90 0.15
91 0.17
92 0.17
93 0.17
94 0.18
95 0.18
96 0.2
97 0.18
98 0.16
99 0.15
100 0.23
101 0.28
102 0.28
103 0.31
104 0.33
105 0.39
106 0.48
107 0.56
108 0.52
109 0.5
110 0.5
111 0.51
112 0.52
113 0.46
114 0.37
115 0.3
116 0.27
117 0.25
118 0.22
119 0.19
120 0.13
121 0.1
122 0.1
123 0.1
124 0.1
125 0.1
126 0.1
127 0.12
128 0.12
129 0.13
130 0.14
131 0.12
132 0.13
133 0.17
134 0.19
135 0.2
136 0.28
137 0.35
138 0.44
139 0.51
140 0.58
141 0.63
142 0.71
143 0.72
144 0.7
145 0.67
146 0.61
147 0.55
148 0.47
149 0.39
150 0.29
151 0.26
152 0.2
153 0.15
154 0.12
155 0.11
156 0.11
157 0.11
158 0.13
159 0.12
160 0.14
161 0.14
162 0.13
163 0.18
164 0.18
165 0.2
166 0.21
167 0.2
168 0.21
169 0.21
170 0.22
171 0.17
172 0.18
173 0.17
174 0.14
175 0.15
176 0.13
177 0.12
178 0.11
179 0.1
180 0.09
181 0.07
182 0.11
183 0.13
184 0.14
185 0.17