Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GH24

Protein Details
Accession A0A397GH24    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-85PAYSSARKSWKKEKRKENTLKRKVEMEKHydrophilic
NLS Segment(s)
PositionSequence
64-81RKSWKKEKRKENTLKRKV
Subcellular Location(s) mito 22, nucl 4.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MFRQPENPSNSRLALRPVRYGRLVSLYLMGYPKFPNLEVVSLHYIPRPLVTTDFPYVPAYSSARKSWKKEKRKENTLKRKVEMEKACRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.44
4 0.43
5 0.45
6 0.45
7 0.44
8 0.37
9 0.34
10 0.32
11 0.23
12 0.22
13 0.18
14 0.17
15 0.17
16 0.15
17 0.12
18 0.12
19 0.12
20 0.11
21 0.11
22 0.13
23 0.12
24 0.14
25 0.13
26 0.15
27 0.18
28 0.17
29 0.18
30 0.15
31 0.14
32 0.13
33 0.13
34 0.11
35 0.08
36 0.1
37 0.11
38 0.15
39 0.16
40 0.16
41 0.17
42 0.17
43 0.16
44 0.15
45 0.16
46 0.14
47 0.16
48 0.19
49 0.22
50 0.3
51 0.36
52 0.42
53 0.51
54 0.59
55 0.66
56 0.73
57 0.8
58 0.81
59 0.87
60 0.91
61 0.92
62 0.93
63 0.92
64 0.91
65 0.83
66 0.82
67 0.76
68 0.75
69 0.73