Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J9E0

Protein Details
Accession A0A397J9E0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-86IKVETLRKNLKKSKRKVENNEYEGKKHydrophilic
NLS Segment(s)
PositionSequence
51-76PERNKGKKRIIKVETLRKNLKKSKRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSEEIIQPALARNLRKIKNEEGFEYESNSSPTSQRPVSPERQKDSEKQIEPERNKGKKRIIKVETLRKNLKKSKRKVENNEYEGKKNDEYASVIFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.5
4 0.53
5 0.57
6 0.59
7 0.55
8 0.51
9 0.5
10 0.44
11 0.42
12 0.35
13 0.28
14 0.26
15 0.23
16 0.18
17 0.15
18 0.17
19 0.18
20 0.18
21 0.19
22 0.22
23 0.28
24 0.36
25 0.44
26 0.48
27 0.48
28 0.53
29 0.53
30 0.52
31 0.55
32 0.54
33 0.46
34 0.43
35 0.45
36 0.48
37 0.47
38 0.52
39 0.54
40 0.53
41 0.55
42 0.57
43 0.6
44 0.58
45 0.63
46 0.64
47 0.58
48 0.6
49 0.66
50 0.7
51 0.69
52 0.71
53 0.73
54 0.68
55 0.73
56 0.72
57 0.74
58 0.73
59 0.75
60 0.78
61 0.8
62 0.86
63 0.88
64 0.9
65 0.9
66 0.86
67 0.86
68 0.79
69 0.73
70 0.66
71 0.6
72 0.5
73 0.43
74 0.38
75 0.31
76 0.29