Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JMY1

Protein Details
Accession A0A397JMY1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MELKPQKMKRKHFNDEEKIFHRBasic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006597  Sel1-like  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF08238  Sel1  
Amino Acid Sequences MELKPQKMKRKHFNDEEKIFHRYLKSAKEGNADGQNKLGYCYLLGIGTTKDDENAFRWYIKSAEEGNSGGQYSLANCYFYGIDTTKDEKKALRWYLKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.85
3 0.82
4 0.75
5 0.7
6 0.6
7 0.52
8 0.42
9 0.36
10 0.35
11 0.33
12 0.35
13 0.34
14 0.36
15 0.38
16 0.38
17 0.38
18 0.42
19 0.37
20 0.32
21 0.29
22 0.27
23 0.23
24 0.23
25 0.19
26 0.1
27 0.08
28 0.09
29 0.07
30 0.06
31 0.06
32 0.06
33 0.05
34 0.06
35 0.07
36 0.06
37 0.06
38 0.06
39 0.07
40 0.09
41 0.12
42 0.12
43 0.12
44 0.12
45 0.13
46 0.14
47 0.14
48 0.14
49 0.13
50 0.15
51 0.16
52 0.16
53 0.16
54 0.16
55 0.15
56 0.12
57 0.11
58 0.08
59 0.07
60 0.11
61 0.11
62 0.11
63 0.1
64 0.12
65 0.12
66 0.12
67 0.16
68 0.12
69 0.14
70 0.18
71 0.23
72 0.27
73 0.29
74 0.3
75 0.29
76 0.35
77 0.42
78 0.47
79 0.52