Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397ITC3

Protein Details
Accession A0A397ITC3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-44KIFIKIFDKNKQNSRNKKNKYKNKKEFASSSHydrophilic
NLS Segment(s)
PositionSequence
28-37RNKKNKYKNK
90-97KKKRKKRK
Subcellular Location(s) nucl 13.5, cyto_nucl 8.833, mito 8.5, cyto_mito 6.333, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKLLIHLLKNQLEKIFIKIFDKNKQNSRNKKNKYKNKKEFASSSSFSFLFLSSLSSFSVISSSLSSSLLLSKKKQMIMMMMNLHHFCHLKKKRKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.28
4 0.28
5 0.32
6 0.37
7 0.42
8 0.49
9 0.51
10 0.56
11 0.64
12 0.71
13 0.75
14 0.8
15 0.82
16 0.84
17 0.88
18 0.9
19 0.91
20 0.92
21 0.92
22 0.92
23 0.91
24 0.87
25 0.81
26 0.75
27 0.68
28 0.63
29 0.53
30 0.44
31 0.37
32 0.31
33 0.26
34 0.21
35 0.17
36 0.1
37 0.09
38 0.09
39 0.07
40 0.08
41 0.08
42 0.08
43 0.08
44 0.07
45 0.08
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.07
54 0.11
55 0.15
56 0.17
57 0.18
58 0.25
59 0.29
60 0.3
61 0.32
62 0.3
63 0.31
64 0.32
65 0.36
66 0.33
67 0.3
68 0.32
69 0.3
70 0.29
71 0.27
72 0.24
73 0.2
74 0.27
75 0.36
76 0.44
77 0.54