Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GZ70

Protein Details
Accession A0A397GZ70    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-38KKKTVDKFKKAGFRKRPRDNSDQLBasic
NLS Segment(s)
PositionSequence
15-32KKKTVDKFKKAGFRKRPR
48-53PKKAKK
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MKAVVRETIKAVQEKKKTVDKFKKAGFRKRPRDNSDQLSLCLMTPNKPKKAKKVKACADAHYEDSEESRLSGSPSQRSDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.58
4 0.6
5 0.64
6 0.69
7 0.68
8 0.69
9 0.71
10 0.75
11 0.74
12 0.78
13 0.79
14 0.79
15 0.81
16 0.84
17 0.87
18 0.84
19 0.84
20 0.8
21 0.74
22 0.7
23 0.61
24 0.51
25 0.42
26 0.35
27 0.26
28 0.23
29 0.18
30 0.14
31 0.22
32 0.28
33 0.35
34 0.43
35 0.47
36 0.55
37 0.66
38 0.72
39 0.73
40 0.77
41 0.78
42 0.8
43 0.79
44 0.72
45 0.67
46 0.61
47 0.53
48 0.44
49 0.36
50 0.26
51 0.24
52 0.22
53 0.15
54 0.13
55 0.11
56 0.1
57 0.13
58 0.18
59 0.21
60 0.27