Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J0H0

Protein Details
Accession A0A397J0H0    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-38DYLKLRKTTEKKKTTEKAKRRSIRVVLHydrophilic
82-107KEPKEPKGSKGPKGPKRPKGPKGPKNBasic
NLS Segment(s)
PositionSequence
17-42RKTTEKKKTTEKAKRRSIRVVLIKKR
73-107RGPKGPKGPKEPKEPKGSKGPKGPKRPKGPKGPKN
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MLETVINNLLNDYLKLRKTTEKKKTTEKAKRRSIRVVLIKKRERTQEVSDDLEITSNEDFTNSNGVQPHHVLRGPKGPKGPKEPKEPKGSKGPKGPKRPKGPKGPKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.24
4 0.32
5 0.41
6 0.51
7 0.59
8 0.62
9 0.65
10 0.74
11 0.8
12 0.81
13 0.83
14 0.83
15 0.82
16 0.84
17 0.86
18 0.82
19 0.81
20 0.75
21 0.73
22 0.73
23 0.73
24 0.71
25 0.73
26 0.74
27 0.7
28 0.69
29 0.66
30 0.6
31 0.56
32 0.52
33 0.49
34 0.45
35 0.43
36 0.38
37 0.32
38 0.28
39 0.22
40 0.17
41 0.12
42 0.08
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.11
49 0.1
50 0.12
51 0.13
52 0.14
53 0.15
54 0.17
55 0.18
56 0.16
57 0.18
58 0.18
59 0.18
60 0.27
61 0.29
62 0.31
63 0.37
64 0.41
65 0.45
66 0.55
67 0.62
68 0.6
69 0.68
70 0.73
71 0.73
72 0.78
73 0.75
74 0.69
75 0.7
76 0.71
77 0.68
78 0.69
79 0.72
80 0.71
81 0.79
82 0.85
83 0.84
84 0.87
85 0.9
86 0.89
87 0.9