Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IRP5

Protein Details
Accession A0A397IRP5    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-31ATASTTRKRGRLRKEKATLPHydrophilic
44-64APAPDAKKRGRPRKVQKVEVTHydrophilic
NLS Segment(s)
PositionSequence
19-25KRGRLRK
50-57KKRGRPRK
Subcellular Location(s) nucl 19.5, mito_nucl 13.166, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MNNNNNSMDNSATASTTRKRGRLRKEKATLPIASTTSTSTSTSAPAPDAKKRGRPRKVQKVEVTDCQKITNIKNFIIKNHPSVANGSEEIADDSPESMKMAKKLWENVINYEKKYLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.28
4 0.32
5 0.37
6 0.46
7 0.54
8 0.64
9 0.71
10 0.76
11 0.78
12 0.81
13 0.8
14 0.78
15 0.75
16 0.65
17 0.56
18 0.51
19 0.41
20 0.34
21 0.28
22 0.22
23 0.17
24 0.17
25 0.16
26 0.13
27 0.13
28 0.13
29 0.13
30 0.13
31 0.12
32 0.15
33 0.17
34 0.21
35 0.27
36 0.28
37 0.37
38 0.46
39 0.55
40 0.59
41 0.67
42 0.73
43 0.78
44 0.83
45 0.82
46 0.78
47 0.76
48 0.71
49 0.68
50 0.63
51 0.54
52 0.46
53 0.38
54 0.34
55 0.29
56 0.28
57 0.29
58 0.26
59 0.26
60 0.32
61 0.32
62 0.33
63 0.38
64 0.37
65 0.32
66 0.34
67 0.33
68 0.28
69 0.29
70 0.27
71 0.22
72 0.2
73 0.18
74 0.14
75 0.13
76 0.14
77 0.12
78 0.11
79 0.08
80 0.08
81 0.09
82 0.08
83 0.09
84 0.09
85 0.12
86 0.14
87 0.17
88 0.22
89 0.27
90 0.33
91 0.4
92 0.46
93 0.45
94 0.5
95 0.57
96 0.56
97 0.52