Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397HCW1

Protein Details
Accession A0A397HCW1    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
225-260EHDRRTSYDRRSRSRSPERRSSYSRRRSRSPVRRRRBasic
NLS Segment(s)
PositionSequence
190-201GREGREGREGRG
205-210RDRDRG
213-260ERDRHRDRSSRFEHDRRTSYDRRSRSRSPERRSSYSRRRSRSPVRRRR
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004882  Luc7-rel  
Gene Ontology GO:0005685  C:U1 snRNP  
GO:0003729  F:mRNA binding  
GO:0006376  P:mRNA splice site selection  
Pfam View protein in Pfam  
PF03194  LUC7  
Amino Acid Sequences MDLGACPKIHSERLKSEYEEGKKRKENDFDSEFERNLANFVADCDRKIACAQKRLDKTPEDSAKVSQLTRDIENLATEISELTKEVEVLGEEGKVTESMKLLQDVEAKKTAKIEKEKELKNQSEGGGPSQQQKLRVCEVCSAYLSIFDSDRRLADHFGGKMHLGYLKIRDLLKELKEKNKDRNNDTRGEGREGREGREGRGYHDRDRDRGNYERDRHRDRSSRFEHDRRTSYDRRSRSRSPERRSSYSRRRSRSPVRRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.56
4 0.57
5 0.59
6 0.62
7 0.58
8 0.63
9 0.66
10 0.68
11 0.69
12 0.69
13 0.66
14 0.65
15 0.64
16 0.58
17 0.57
18 0.55
19 0.47
20 0.39
21 0.35
22 0.26
23 0.22
24 0.19
25 0.13
26 0.09
27 0.11
28 0.18
29 0.17
30 0.18
31 0.19
32 0.19
33 0.19
34 0.22
35 0.29
36 0.28
37 0.35
38 0.4
39 0.47
40 0.54
41 0.58
42 0.6
43 0.56
44 0.54
45 0.56
46 0.57
47 0.52
48 0.47
49 0.43
50 0.42
51 0.4
52 0.35
53 0.26
54 0.24
55 0.23
56 0.22
57 0.22
58 0.19
59 0.17
60 0.17
61 0.16
62 0.12
63 0.09
64 0.08
65 0.07
66 0.06
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.07
76 0.07
77 0.06
78 0.05
79 0.05
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.08
86 0.09
87 0.1
88 0.1
89 0.11
90 0.16
91 0.17
92 0.19
93 0.23
94 0.23
95 0.22
96 0.26
97 0.28
98 0.28
99 0.35
100 0.36
101 0.39
102 0.47
103 0.5
104 0.54
105 0.58
106 0.53
107 0.48
108 0.46
109 0.38
110 0.33
111 0.3
112 0.24
113 0.19
114 0.19
115 0.2
116 0.22
117 0.22
118 0.24
119 0.26
120 0.27
121 0.3
122 0.31
123 0.29
124 0.29
125 0.29
126 0.25
127 0.24
128 0.21
129 0.16
130 0.14
131 0.13
132 0.1
133 0.09
134 0.08
135 0.09
136 0.09
137 0.09
138 0.1
139 0.1
140 0.11
141 0.12
142 0.16
143 0.15
144 0.15
145 0.16
146 0.14
147 0.13
148 0.13
149 0.12
150 0.1
151 0.1
152 0.12
153 0.13
154 0.16
155 0.16
156 0.16
157 0.18
158 0.22
159 0.25
160 0.31
161 0.34
162 0.39
163 0.48
164 0.53
165 0.6
166 0.63
167 0.65
168 0.64
169 0.7
170 0.66
171 0.62
172 0.6
173 0.57
174 0.52
175 0.52
176 0.48
177 0.4
178 0.44
179 0.4
180 0.4
181 0.4
182 0.38
183 0.33
184 0.38
185 0.36
186 0.33
187 0.41
188 0.42
189 0.41
190 0.5
191 0.51
192 0.47
193 0.52
194 0.51
195 0.47
196 0.51
197 0.52
198 0.52
199 0.57
200 0.63
201 0.66
202 0.7
203 0.7
204 0.72
205 0.73
206 0.68
207 0.71
208 0.69
209 0.7
210 0.72
211 0.74
212 0.75
213 0.74
214 0.75
215 0.72
216 0.73
217 0.7
218 0.71
219 0.73
220 0.72
221 0.72
222 0.74
223 0.76
224 0.78
225 0.82
226 0.82
227 0.81
228 0.83
229 0.83
230 0.83
231 0.83
232 0.83
233 0.83
234 0.84
235 0.85
236 0.81
237 0.81
238 0.82
239 0.85
240 0.86