Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397G7I1

Protein Details
Accession A0A397G7I1    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-61SLTTNAKKRQKKSRMRALMNNEKKHydrophilic
63-83IKVSKSVDKLLKRKKSKNVWEHydrophilic
NLS Segment(s)
PositionSequence
42-79NAKKRQKKSRMRALMNNEKKEIKVSKSVDKLLKRKKSK
Subcellular Location(s) nucl 21, cyto_nucl 13.833, mito_nucl 12.499, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGRKRSDMLIDSPLNNSGPTINQSSDNLLRRIKKNPNSLTTNAKKRQKKSRMRALMNNEKKEIKVSKSVDKLLKRKKSKNVWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.2
4 0.14
5 0.12
6 0.14
7 0.16
8 0.15
9 0.16
10 0.17
11 0.21
12 0.26
13 0.28
14 0.28
15 0.29
16 0.34
17 0.35
18 0.42
19 0.47
20 0.49
21 0.56
22 0.58
23 0.6
24 0.6
25 0.6
26 0.61
27 0.59
28 0.6
29 0.58
30 0.61
31 0.61
32 0.62
33 0.71
34 0.72
35 0.75
36 0.76
37 0.8
38 0.81
39 0.81
40 0.82
41 0.81
42 0.82
43 0.8
44 0.74
45 0.66
46 0.57
47 0.51
48 0.49
49 0.44
50 0.37
51 0.37
52 0.37
53 0.43
54 0.47
55 0.54
56 0.56
57 0.6
58 0.66
59 0.68
60 0.74
61 0.76
62 0.79
63 0.83