Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1WYR7

Protein Details
Accession K1WYR7    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
175-210KHFGMGPHKHKKPKVESKGRKFEKARGRRASRGFKVBasic
NLS Segment(s)
PositionSequence
172-210EAVKHFGMGPHKHKKPKVESKGRKFEKARGRRASRGFKV
Subcellular Location(s) mito 10, cyto_nucl 9.5, cyto 9, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR021132  Ribosomal_L18/L18-A/B/e_CS  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mbe:MBM_07969  -  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
PROSITE View protein in PROSITE  
PS01106  RIBOSOMAL_L18E  
Amino Acid Sequences MCMILVAGGKFLFISNDINDNSTTAKMGIDLDAHHVRNTHRKAPKSDNVYLKLLVKLYRFLARRTESSFNKVVLRRLFMSRINRPPVSISRIVANTSEKSNNKTIVVIGTITDDNRLLTVPKLSVAALRFTATARARIIAAGGEALTLDQLALRAPTGSNTLLLRGPKNSREAVKHFGMGPHKHKKPKVESKGRKFEKARGRRASRGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.17
4 0.18
5 0.19
6 0.19
7 0.19
8 0.19
9 0.17
10 0.16
11 0.11
12 0.11
13 0.1
14 0.1
15 0.1
16 0.1
17 0.1
18 0.16
19 0.21
20 0.21
21 0.21
22 0.23
23 0.25
24 0.34
25 0.39
26 0.42
27 0.45
28 0.5
29 0.57
30 0.64
31 0.69
32 0.67
33 0.69
34 0.68
35 0.64
36 0.61
37 0.55
38 0.47
39 0.41
40 0.35
41 0.3
42 0.23
43 0.21
44 0.21
45 0.26
46 0.26
47 0.26
48 0.32
49 0.32
50 0.34
51 0.37
52 0.43
53 0.38
54 0.42
55 0.43
56 0.37
57 0.39
58 0.38
59 0.38
60 0.33
61 0.34
62 0.3
63 0.3
64 0.32
65 0.31
66 0.37
67 0.39
68 0.44
69 0.47
70 0.44
71 0.42
72 0.43
73 0.41
74 0.39
75 0.33
76 0.26
77 0.23
78 0.24
79 0.24
80 0.22
81 0.2
82 0.16
83 0.16
84 0.21
85 0.19
86 0.22
87 0.24
88 0.24
89 0.22
90 0.21
91 0.19
92 0.14
93 0.14
94 0.1
95 0.07
96 0.08
97 0.07
98 0.07
99 0.07
100 0.07
101 0.06
102 0.06
103 0.06
104 0.05
105 0.06
106 0.07
107 0.06
108 0.07
109 0.08
110 0.07
111 0.1
112 0.1
113 0.11
114 0.1
115 0.11
116 0.11
117 0.1
118 0.17
119 0.15
120 0.17
121 0.16
122 0.16
123 0.15
124 0.15
125 0.15
126 0.09
127 0.08
128 0.06
129 0.05
130 0.04
131 0.04
132 0.04
133 0.03
134 0.03
135 0.03
136 0.02
137 0.03
138 0.03
139 0.04
140 0.04
141 0.05
142 0.05
143 0.06
144 0.09
145 0.09
146 0.11
147 0.11
148 0.13
149 0.15
150 0.18
151 0.19
152 0.22
153 0.26
154 0.28
155 0.32
156 0.35
157 0.37
158 0.41
159 0.45
160 0.46
161 0.43
162 0.42
163 0.39
164 0.4
165 0.43
166 0.43
167 0.47
168 0.51
169 0.57
170 0.64
171 0.67
172 0.72
173 0.75
174 0.79
175 0.81
176 0.82
177 0.85
178 0.87
179 0.93
180 0.9
181 0.88
182 0.81
183 0.79
184 0.79
185 0.78
186 0.78
187 0.78
188 0.8
189 0.79
190 0.85