Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JPZ7

Protein Details
Accession A0A397JPZ7    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-41VYLEYRKVKKEWKKLHKETKRKWKEDYBasic
48-69IEGEMKFKKKLKKKVTFRGDVGBasic
NLS Segment(s)
PositionSequence
20-61RKVKKEWKKLHKETKRKWKEDYERRKLEIEGEMKFKKKLKKK
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MNSAISYLIPRKVKVYLEYRKVKKEWKKLHKETKRKWKEDYERRKLEIEGEMKFKKKLKKKVTFRGDVGVRGEYIVYEVRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.43
4 0.5
5 0.59
6 0.62
7 0.65
8 0.65
9 0.68
10 0.68
11 0.7
12 0.71
13 0.72
14 0.78
15 0.81
16 0.89
17 0.9
18 0.91
19 0.9
20 0.91
21 0.9
22 0.83
23 0.78
24 0.77
25 0.78
26 0.78
27 0.79
28 0.77
29 0.72
30 0.7
31 0.67
32 0.56
33 0.48
34 0.44
35 0.36
36 0.28
37 0.3
38 0.3
39 0.3
40 0.33
41 0.36
42 0.38
43 0.44
44 0.53
45 0.57
46 0.66
47 0.75
48 0.82
49 0.87
50 0.85
51 0.78
52 0.77
53 0.68
54 0.61
55 0.54
56 0.44
57 0.34
58 0.27
59 0.24
60 0.15
61 0.15