Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IKC9

Protein Details
Accession A0A397IKC9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
41-66ASIKYQQKDRKDEKSEKKFWGKRVKSHydrophilic
NLS Segment(s)
PositionSequence
31-64KRKKDKKINLASIKYQQKDRKDEKSEKKFWGKRV
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 2
Family & Domain DBs
Amino Acid Sequences MNMQQPSRFEGHTRPVTLDDNDRKYNIETNKRKKDKKINLASIKYQQKDRKDEKSEKKFWGKRVKSELI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.39
4 0.38
5 0.41
6 0.4
7 0.39
8 0.4
9 0.38
10 0.37
11 0.35
12 0.39
13 0.38
14 0.41
15 0.45
16 0.53
17 0.64
18 0.71
19 0.74
20 0.76
21 0.8
22 0.79
23 0.8
24 0.8
25 0.79
26 0.79
27 0.77
28 0.73
29 0.7
30 0.67
31 0.59
32 0.57
33 0.53
34 0.52
35 0.58
36 0.61
37 0.63
38 0.65
39 0.73
40 0.76
41 0.8
42 0.8
43 0.79
44 0.83
45 0.79
46 0.8
47 0.81
48 0.76
49 0.75