Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397I2F6

Protein Details
Accession A0A397I2F6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
76-102CYECFHCKRAKYEEKKRRQGVEVKRKRBasic
NLS Segment(s)
PositionSequence
86-102KYEEKKRRQGVEVKRKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, mito 3
Family & Domain DBs
Amino Acid Sequences MKNQNQDQQEFNPMIHLESDLFRKENLLLNFKEPEESPVVKYKYTTKCCLYNEKNHGDDDDNDSFYEYLTDDGIDCYECFHCKRAKYEEKKRRQGVEVKRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.2
3 0.18
4 0.13
5 0.14
6 0.17
7 0.16
8 0.16
9 0.16
10 0.16
11 0.17
12 0.22
13 0.24
14 0.26
15 0.25
16 0.27
17 0.3
18 0.28
19 0.28
20 0.22
21 0.21
22 0.2
23 0.2
24 0.19
25 0.25
26 0.26
27 0.25
28 0.26
29 0.31
30 0.36
31 0.4
32 0.42
33 0.38
34 0.43
35 0.45
36 0.54
37 0.5
38 0.49
39 0.51
40 0.51
41 0.5
42 0.44
43 0.42
44 0.35
45 0.31
46 0.29
47 0.24
48 0.2
49 0.18
50 0.19
51 0.17
52 0.15
53 0.14
54 0.08
55 0.06
56 0.05
57 0.06
58 0.05
59 0.06
60 0.06
61 0.07
62 0.06
63 0.08
64 0.09
65 0.11
66 0.13
67 0.18
68 0.22
69 0.26
70 0.33
71 0.41
72 0.51
73 0.59
74 0.69
75 0.75
76 0.81
77 0.88
78 0.89
79 0.85
80 0.82
81 0.81
82 0.81