Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LJ09

Protein Details
Accession E2LJ09    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
30-49SPFVKAYKKKKLYRLINEQTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 7, cyto 6, E.R. 4, mito 3, golg 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mpr:MPER_06570  -  
Amino Acid Sequences MKPATTWERLTLVPKFLPLPVILAYTALISPFVKAYKKKKLYRLINEQTTRYVTNNFTVPQLQWTSGPSHKVYKAWAKSFKVEPTIEETPEGVKLMWLGKQDAEKVLFICYGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.23
4 0.23
5 0.18
6 0.18
7 0.14
8 0.15
9 0.13
10 0.12
11 0.11
12 0.1
13 0.1
14 0.07
15 0.07
16 0.06
17 0.07
18 0.08
19 0.1
20 0.14
21 0.2
22 0.28
23 0.38
24 0.48
25 0.54
26 0.62
27 0.7
28 0.76
29 0.78
30 0.81
31 0.79
32 0.78
33 0.73
34 0.65
35 0.57
36 0.49
37 0.41
38 0.31
39 0.25
40 0.18
41 0.17
42 0.17
43 0.16
44 0.15
45 0.14
46 0.13
47 0.14
48 0.14
49 0.13
50 0.11
51 0.12
52 0.15
53 0.16
54 0.19
55 0.18
56 0.21
57 0.22
58 0.23
59 0.26
60 0.31
61 0.36
62 0.4
63 0.46
64 0.45
65 0.48
66 0.51
67 0.5
68 0.47
69 0.41
70 0.35
71 0.35
72 0.35
73 0.31
74 0.27
75 0.24
76 0.2
77 0.2
78 0.19
79 0.11
80 0.09
81 0.1
82 0.11
83 0.13
84 0.14
85 0.14
86 0.16
87 0.2
88 0.21
89 0.24
90 0.25
91 0.23
92 0.22
93 0.23