Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JQ06

Protein Details
Accession A0A397JQ06    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
79-101QNDKKLRRIKAAKELFRKNNPNIHydrophilic
NLS Segment(s)
PositionSequence
59-92RMRNSGKLLKDLRRVHANNRQNDKKLRRIKAAKE
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSNTDENDYLKTVVNVYDLSWRSAKVKLQKSLAPKFRSSVTQLTKWLNSIHKSRRATTRMRNSGKLLKDLRRVHANNRQNDKKLRRIKAAKELFRKNNPNITDYDKESLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.12
4 0.19
5 0.19
6 0.21
7 0.21
8 0.21
9 0.22
10 0.25
11 0.3
12 0.32
13 0.39
14 0.42
15 0.45
16 0.49
17 0.55
18 0.61
19 0.64
20 0.58
21 0.51
22 0.47
23 0.45
24 0.44
25 0.39
26 0.38
27 0.34
28 0.34
29 0.36
30 0.37
31 0.35
32 0.33
33 0.32
34 0.28
35 0.26
36 0.31
37 0.34
38 0.39
39 0.41
40 0.43
41 0.48
42 0.49
43 0.52
44 0.54
45 0.58
46 0.59
47 0.61
48 0.61
49 0.57
50 0.59
51 0.54
52 0.52
53 0.47
54 0.43
55 0.48
56 0.48
57 0.49
58 0.51
59 0.51
60 0.52
61 0.57
62 0.58
63 0.58
64 0.65
65 0.67
66 0.63
67 0.71
68 0.7
69 0.7
70 0.73
71 0.7
72 0.71
73 0.73
74 0.74
75 0.75
76 0.79
77 0.78
78 0.78
79 0.81
80 0.79
81 0.81
82 0.81
83 0.76
84 0.75
85 0.68
86 0.61
87 0.55
88 0.54
89 0.49
90 0.45