Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GD18

Protein Details
Accession A0A397GD18    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
31-58QNRKEICTFKPQKKRGPKPKRVESPSVEHydrophilic
NLS Segment(s)
PositionSequence
41-51PQKKRGPKPKR
Subcellular Location(s) nucl 14, mito 11, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MTRKHSTHACTNCVIARRCIRPSETECVRCQNRKEICTFKPQKKRGPKPKRVESPSVEETFSFNLNYKFLPNEAPISFEFKFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.42
4 0.43
5 0.44
6 0.46
7 0.44
8 0.44
9 0.47
10 0.48
11 0.49
12 0.47
13 0.46
14 0.5
15 0.53
16 0.52
17 0.49
18 0.5
19 0.48
20 0.46
21 0.5
22 0.48
23 0.45
24 0.51
25 0.56
26 0.56
27 0.6
28 0.64
29 0.67
30 0.72
31 0.8
32 0.81
33 0.84
34 0.85
35 0.85
36 0.9
37 0.9
38 0.86
39 0.82
40 0.75
41 0.71
42 0.66
43 0.58
44 0.48
45 0.38
46 0.33
47 0.28
48 0.24
49 0.17
50 0.14
51 0.14
52 0.14
53 0.15
54 0.15
55 0.15
56 0.15
57 0.18
58 0.18
59 0.22
60 0.21
61 0.24
62 0.23
63 0.28