Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JL60

Protein Details
Accession A0A397JL60    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-43RLKGDNPNKIEKKKRKNKGKDKEKLIKYAKBasic
NLS Segment(s)
PositionSequence
20-38PNKIEKKKRKNKGKDKEKL
72-89KKRLDEKVAKAARKSHKE
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MSSEYHNVPGGALRLKGDNPNKIEKKKRKNKGKDKEKLIKYAKEIIEEESETQVIRVVTKTEAEKKFEEIQKKRLDEKVAKAARKSHKERVAELNRKLEEMTEHYDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.28
4 0.31
5 0.35
6 0.37
7 0.47
8 0.54
9 0.6
10 0.69
11 0.71
12 0.76
13 0.8
14 0.86
15 0.87
16 0.9
17 0.93
18 0.93
19 0.94
20 0.92
21 0.92
22 0.91
23 0.84
24 0.83
25 0.78
26 0.71
27 0.63
28 0.62
29 0.52
30 0.45
31 0.41
32 0.34
33 0.3
34 0.26
35 0.23
36 0.16
37 0.15
38 0.11
39 0.1
40 0.1
41 0.08
42 0.07
43 0.07
44 0.07
45 0.08
46 0.1
47 0.12
48 0.19
49 0.21
50 0.24
51 0.25
52 0.28
53 0.34
54 0.37
55 0.45
56 0.4
57 0.46
58 0.5
59 0.52
60 0.52
61 0.5
62 0.52
63 0.48
64 0.5
65 0.53
66 0.52
67 0.51
68 0.5
69 0.54
70 0.57
71 0.61
72 0.62
73 0.61
74 0.63
75 0.63
76 0.65
77 0.68
78 0.69
79 0.68
80 0.67
81 0.65
82 0.58
83 0.56
84 0.51
85 0.41
86 0.34
87 0.31
88 0.31
89 0.26
90 0.26
91 0.26
92 0.28
93 0.27