Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1XPS5

Protein Details
Accession K1XPS5   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
157-179KAVLPRKKVEKAKKPKPPVIREPBasic
NLS Segment(s)
PositionSequence
141-174PAPPKKASKATKKDPTKAVLPRKKVEKAKKPKPP
Subcellular Location(s) nucl 19.5, cyto_nucl 12.833, mito_nucl 11.166, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019194  Tscrpt_elong_fac_Eaf_N  
KEGG mbe:MBM_07260  -  
Pfam View protein in Pfam  
PF09816  EAF  
Amino Acid Sequences MAAMAGGLIDISRPGKYPIVLSDALLGKTSKDIYTGVRFNHKPDTSSSDTPSIHLQPSDSDSDPASYDLSLKDNSEEYSYQGTRTSGDGQYVLIFDPVKEHFVIHRIDSTFEMNMVSTPWTQNTSKLRSQYPQLEPEVKSPAPPKKASKATKKDPTKAVLPRKKVEKAKKPKPPVIREPTPEPQEEEDSDDGLTIEYPEAPTNYQPKSTPLFDRQVSDEDEDAEGEDDDEFEEVQEYNQDVDHLKLPSPANNNAGQLSDEDLELDLEAELEQAFKDGESSESEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.17
4 0.19
5 0.2
6 0.25
7 0.25
8 0.24
9 0.27
10 0.27
11 0.26
12 0.25
13 0.22
14 0.16
15 0.19
16 0.2
17 0.15
18 0.13
19 0.14
20 0.18
21 0.26
22 0.3
23 0.3
24 0.38
25 0.39
26 0.41
27 0.49
28 0.45
29 0.39
30 0.39
31 0.44
32 0.42
33 0.45
34 0.45
35 0.41
36 0.4
37 0.4
38 0.4
39 0.35
40 0.29
41 0.26
42 0.23
43 0.18
44 0.22
45 0.25
46 0.21
47 0.19
48 0.18
49 0.19
50 0.19
51 0.18
52 0.15
53 0.1
54 0.1
55 0.1
56 0.12
57 0.12
58 0.12
59 0.13
60 0.13
61 0.14
62 0.16
63 0.15
64 0.15
65 0.2
66 0.2
67 0.19
68 0.2
69 0.19
70 0.17
71 0.19
72 0.21
73 0.15
74 0.16
75 0.15
76 0.14
77 0.14
78 0.14
79 0.12
80 0.09
81 0.08
82 0.07
83 0.09
84 0.1
85 0.11
86 0.1
87 0.11
88 0.1
89 0.14
90 0.16
91 0.14
92 0.17
93 0.16
94 0.17
95 0.18
96 0.19
97 0.15
98 0.14
99 0.13
100 0.09
101 0.08
102 0.08
103 0.08
104 0.07
105 0.07
106 0.08
107 0.11
108 0.12
109 0.18
110 0.23
111 0.27
112 0.3
113 0.33
114 0.35
115 0.33
116 0.38
117 0.4
118 0.38
119 0.36
120 0.36
121 0.37
122 0.35
123 0.35
124 0.36
125 0.27
126 0.26
127 0.27
128 0.3
129 0.3
130 0.33
131 0.34
132 0.37
133 0.46
134 0.52
135 0.58
136 0.61
137 0.65
138 0.72
139 0.74
140 0.72
141 0.67
142 0.62
143 0.59
144 0.59
145 0.61
146 0.58
147 0.57
148 0.56
149 0.58
150 0.63
151 0.64
152 0.66
153 0.66
154 0.7
155 0.75
156 0.8
157 0.81
158 0.81
159 0.82
160 0.8
161 0.8
162 0.78
163 0.74
164 0.69
165 0.68
166 0.67
167 0.6
168 0.53
169 0.45
170 0.39
171 0.35
172 0.31
173 0.28
174 0.21
175 0.19
176 0.18
177 0.15
178 0.13
179 0.1
180 0.09
181 0.05
182 0.05
183 0.05
184 0.06
185 0.07
186 0.07
187 0.08
188 0.12
189 0.17
190 0.18
191 0.2
192 0.2
193 0.23
194 0.27
195 0.3
196 0.32
197 0.33
198 0.38
199 0.37
200 0.39
201 0.38
202 0.36
203 0.35
204 0.31
205 0.26
206 0.21
207 0.2
208 0.17
209 0.15
210 0.12
211 0.09
212 0.08
213 0.07
214 0.06
215 0.06
216 0.06
217 0.05
218 0.05
219 0.06
220 0.05
221 0.06
222 0.08
223 0.08
224 0.08
225 0.08
226 0.1
227 0.1
228 0.12
229 0.16
230 0.15
231 0.16
232 0.2
233 0.22
234 0.27
235 0.31
236 0.34
237 0.33
238 0.35
239 0.36
240 0.31
241 0.3
242 0.25
243 0.21
244 0.2
245 0.16
246 0.13
247 0.12
248 0.12
249 0.11
250 0.1
251 0.1
252 0.06
253 0.06
254 0.06
255 0.06
256 0.05
257 0.05
258 0.05
259 0.06
260 0.06
261 0.05
262 0.06
263 0.07
264 0.09
265 0.12