Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397I222

Protein Details
Accession A0A397I222    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-33DLKTCDLTKKPTEKTKKTKRPKYTENACTVCHydrophilic
52-81KSLKRICVKKFQNKRGRKKKQNENEQNDIDHydrophilic
NLS Segment(s)
PositionSequence
16-22KTKKTKR
63-71QNKRGRKKK
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
Amino Acid Sequences MVDLKTCDLTKKPTEKTKKTKRPKYTENACTVCANAKKKCERELVDICNRCKSLKRICVKKFQNKRGRKKKQNENEQNDIDTFDVDYVFSETEAPISSILNYEERKLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.73
3 0.8
4 0.85
5 0.87
6 0.89
7 0.92
8 0.93
9 0.92
10 0.91
11 0.91
12 0.9
13 0.87
14 0.85
15 0.77
16 0.68
17 0.58
18 0.49
19 0.44
20 0.4
21 0.38
22 0.33
23 0.38
24 0.43
25 0.46
26 0.51
27 0.53
28 0.5
29 0.52
30 0.55
31 0.55
32 0.56
33 0.58
34 0.53
35 0.5
36 0.46
37 0.39
38 0.36
39 0.35
40 0.35
41 0.38
42 0.45
43 0.52
44 0.55
45 0.65
46 0.69
47 0.74
48 0.75
49 0.77
50 0.8
51 0.8
52 0.87
53 0.88
54 0.91
55 0.91
56 0.91
57 0.91
58 0.91
59 0.93
60 0.92
61 0.89
62 0.86
63 0.77
64 0.68
65 0.58
66 0.48
67 0.37
68 0.26
69 0.18
70 0.1
71 0.08
72 0.06
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.08
80 0.09
81 0.09
82 0.08
83 0.08
84 0.08
85 0.09
86 0.12
87 0.17
88 0.17