Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1X8R2

Protein Details
Accession K1X8R2   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
29-58ASVHIPRRRGHQRHLRRRRPTQQPPPRGDLBasic
NLS Segment(s)
PositionSequence
34-49PRRRGHQRHLRRRRPT
Subcellular Location(s) mito 8extr 8, nucl 6, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038445  NCDase_C_sf  
IPR031331  NEUT/ALK_ceramidase_C  
KEGG mbe:MBM_00565  -  
Pfam View protein in Pfam  
PF17048  Ceramidse_alk_C  
Amino Acid Sequences MPSAPGQQVGRTPALDQGLFMTCLSGKIASVHIPRRRGHQRHLRRRRPTQQPPPRGDLCRGPAAGGRRLDDGDWLFAYTWYRDNGLIGTSHMVLSWETESYAANGTYRFKYNGDSKVLGAAITAFPGTSESFTLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.2
4 0.19
5 0.18
6 0.18
7 0.17
8 0.14
9 0.11
10 0.12
11 0.12
12 0.1
13 0.08
14 0.09
15 0.1
16 0.15
17 0.21
18 0.29
19 0.33
20 0.39
21 0.4
22 0.48
23 0.57
24 0.57
25 0.61
26 0.63
27 0.69
28 0.75
29 0.85
30 0.86
31 0.85
32 0.9
33 0.9
34 0.9
35 0.9
36 0.89
37 0.89
38 0.88
39 0.83
40 0.79
41 0.74
42 0.65
43 0.57
44 0.5
45 0.43
46 0.37
47 0.32
48 0.27
49 0.24
50 0.25
51 0.27
52 0.23
53 0.21
54 0.18
55 0.18
56 0.17
57 0.17
58 0.14
59 0.11
60 0.1
61 0.09
62 0.08
63 0.09
64 0.1
65 0.08
66 0.1
67 0.09
68 0.1
69 0.1
70 0.1
71 0.1
72 0.1
73 0.09
74 0.08
75 0.09
76 0.08
77 0.08
78 0.07
79 0.08
80 0.07
81 0.08
82 0.08
83 0.07
84 0.07
85 0.07
86 0.08
87 0.08
88 0.1
89 0.08
90 0.08
91 0.1
92 0.13
93 0.15
94 0.18
95 0.19
96 0.18
97 0.23
98 0.29
99 0.34
100 0.37
101 0.36
102 0.33
103 0.35
104 0.34
105 0.28
106 0.22
107 0.17
108 0.11
109 0.1
110 0.1
111 0.06
112 0.06
113 0.08
114 0.09
115 0.09