Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IMC2

Protein Details
Accession A0A397IMC2    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-45AGDFFKRRVSRQKKRKLSNSEIKYLEHydrophilic
NLS Segment(s)
PositionSequence
25-37KRRVSRQKKRKLS
115-177KGIKYREKREPNSGIKGIKYLEKRRPPNFGVKGIKYREKRDPPNFGIKGVKYLEKREPKPIRG
Subcellular Location(s) E.R. 8, extr 5, nucl 4, mito 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MKFNRVLFLLSILLFVTFVAGDFFKRRVSRQKKRKLSNSEIKYLEKKELPNSGIKGIKYLEKRDPPNFGIKGIKYLEKREPNSGIKGIKYLEKREPNSGIKGIKYLENSPNSGIKGIKYREKREPNSGIKGIKYLEKRRPPNFGVKGIKYREKRDPPNFGIKGVKYLEKREPKPIRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.07
4 0.05
5 0.05
6 0.06
7 0.06
8 0.08
9 0.11
10 0.12
11 0.18
12 0.2
13 0.26
14 0.35
15 0.46
16 0.56
17 0.64
18 0.74
19 0.79
20 0.87
21 0.91
22 0.9
23 0.9
24 0.89
25 0.84
26 0.81
27 0.74
28 0.68
29 0.64
30 0.56
31 0.51
32 0.44
33 0.41
34 0.38
35 0.4
36 0.38
37 0.38
38 0.37
39 0.37
40 0.37
41 0.34
42 0.31
43 0.26
44 0.3
45 0.28
46 0.31
47 0.34
48 0.37
49 0.43
50 0.44
51 0.49
52 0.45
53 0.49
54 0.45
55 0.39
56 0.37
57 0.31
58 0.32
59 0.29
60 0.32
61 0.25
62 0.29
63 0.35
64 0.38
65 0.4
66 0.4
67 0.43
68 0.41
69 0.42
70 0.41
71 0.34
72 0.27
73 0.26
74 0.23
75 0.24
76 0.23
77 0.25
78 0.3
79 0.36
80 0.38
81 0.4
82 0.45
83 0.41
84 0.42
85 0.41
86 0.34
87 0.27
88 0.26
89 0.23
90 0.2
91 0.2
92 0.21
93 0.23
94 0.24
95 0.25
96 0.25
97 0.27
98 0.24
99 0.23
100 0.2
101 0.16
102 0.21
103 0.23
104 0.29
105 0.34
106 0.39
107 0.48
108 0.57
109 0.6
110 0.62
111 0.68
112 0.67
113 0.67
114 0.65
115 0.56
116 0.47
117 0.43
118 0.35
119 0.32
120 0.34
121 0.35
122 0.41
123 0.5
124 0.58
125 0.61
126 0.68
127 0.66
128 0.69
129 0.66
130 0.66
131 0.64
132 0.61
133 0.65
134 0.64
135 0.69
136 0.64
137 0.65
138 0.66
139 0.68
140 0.73
141 0.73
142 0.77
143 0.74
144 0.79
145 0.73
146 0.67
147 0.64
148 0.54
149 0.51
150 0.45
151 0.46
152 0.39
153 0.44
154 0.51
155 0.53
156 0.56
157 0.61