Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GKT1

Protein Details
Accession A0A397GKT1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
49-80RGPKGPKGPKGPKGPKGPKGPKGPKGPKGSKNBasic
NLS Segment(s)
PositionSequence
49-80RGPKGPKGPKGPKGPKGPKGPKGPKGPKGSKN
Subcellular Location(s) cyto 10, nucl 9, mito 7
Family & Domain DBs
Amino Acid Sequences MQGQTSSWNQIEITSFDRSAIKTDKQMLMEYEIFGIMESLNIDKDHVLRGPKGPKGPKGPKGPKGPKGPKGPKGPKGSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.19
4 0.2
5 0.19
6 0.22
7 0.24
8 0.23
9 0.24
10 0.29
11 0.31
12 0.3
13 0.31
14 0.28
15 0.27
16 0.26
17 0.22
18 0.17
19 0.13
20 0.12
21 0.1
22 0.09
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.05
30 0.05
31 0.06
32 0.07
33 0.09
34 0.11
35 0.12
36 0.18
37 0.23
38 0.27
39 0.34
40 0.37
41 0.41
42 0.5
43 0.58
44 0.6
45 0.66
46 0.71
47 0.72
48 0.79
49 0.81
50 0.79
51 0.81
52 0.82
53 0.79
54 0.81
55 0.82
56 0.79
57 0.81
58 0.82
59 0.79
60 0.81