Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JFA1

Protein Details
Accession A0A397JFA1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
26-46LIAPRNRKKINNNNNNNNNNNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, cyto_mito 6.5, pero 5, plas 4, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000898  Indolamine_dOase  
Gene Ontology GO:0016020  C:membrane  
GO:0020037  F:heme binding  
Pfam View protein in Pfam  
PF01231  IDO  
Amino Acid Sequences MYSVKENKYKERGIMIFKVNCFYSFLIAPRNRKKINNNNNNNNNNNNLKCPFNNMNNKQKPYLYKIRENMPGPHRRFLEDLSKIANIXLSNFLSLFFQKFFFLVLLFSYLVRVYPILIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.52
3 0.49
4 0.47
5 0.46
6 0.39
7 0.35
8 0.31
9 0.25
10 0.2
11 0.18
12 0.18
13 0.25
14 0.29
15 0.37
16 0.43
17 0.52
18 0.53
19 0.58
20 0.66
21 0.68
22 0.74
23 0.76
24 0.78
25 0.79
26 0.85
27 0.85
28 0.78
29 0.69
30 0.63
31 0.58
32 0.49
33 0.42
34 0.34
35 0.3
36 0.27
37 0.32
38 0.31
39 0.34
40 0.43
41 0.45
42 0.54
43 0.58
44 0.6
45 0.55
46 0.53
47 0.48
48 0.44
49 0.48
50 0.42
51 0.42
52 0.43
53 0.47
54 0.51
55 0.5
56 0.5
57 0.48
58 0.53
59 0.49
60 0.51
61 0.47
62 0.43
63 0.42
64 0.38
65 0.39
66 0.33
67 0.31
68 0.28
69 0.27
70 0.25
71 0.23
72 0.23
73 0.14
74 0.13
75 0.13
76 0.1
77 0.1
78 0.11
79 0.12
80 0.1
81 0.12
82 0.11
83 0.11
84 0.11
85 0.11
86 0.11
87 0.11
88 0.1
89 0.09
90 0.09
91 0.1
92 0.1
93 0.1
94 0.1
95 0.1
96 0.1
97 0.1
98 0.1