Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397H9P0

Protein Details
Accession A0A397H9P0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-67PPSNDKDGKRHEKRDKTITCTBasic
NLS Segment(s)
Subcellular Location(s) extr 9, golg 8, E.R. 5, mito 2, cyto 1, pero 1, vacu 1, mito_nucl 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MGRQTLKLFLIVLFLSTITVNSKRVSTTITSTDFFCQTDKLNCPTFPPSNDKDGKRHEKRDKTITCTYVKCLGSDGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.09
6 0.11
7 0.12
8 0.13
9 0.14
10 0.14
11 0.14
12 0.16
13 0.15
14 0.17
15 0.19
16 0.21
17 0.21
18 0.22
19 0.23
20 0.22
21 0.2
22 0.17
23 0.13
24 0.12
25 0.15
26 0.17
27 0.19
28 0.21
29 0.21
30 0.23
31 0.27
32 0.28
33 0.28
34 0.31
35 0.3
36 0.36
37 0.42
38 0.42
39 0.44
40 0.51
41 0.59
42 0.61
43 0.69
44 0.71
45 0.75
46 0.79
47 0.83
48 0.8
49 0.77
50 0.76
51 0.71
52 0.67
53 0.59
54 0.56
55 0.54
56 0.48
57 0.4