Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JF78

Protein Details
Accession A0A397JF78    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
81-102NYGSSLRKYKEKKITKEQMEEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12.333, mito_nucl 11.333, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MTNWQLKKIKEVQKELVIDSLKDAFKGRQHETKVIMIEGSCEAGKSTFVGKCKEYLTKYKKTVEILDESFITKDSSKRIINYGSSLRKYKEKKITKEQMEEIAIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.57
3 0.53
4 0.44
5 0.36
6 0.3
7 0.29
8 0.22
9 0.2
10 0.21
11 0.18
12 0.22
13 0.28
14 0.31
15 0.33
16 0.37
17 0.4
18 0.42
19 0.43
20 0.39
21 0.33
22 0.28
23 0.21
24 0.18
25 0.14
26 0.12
27 0.08
28 0.07
29 0.07
30 0.07
31 0.07
32 0.06
33 0.09
34 0.1
35 0.13
36 0.15
37 0.15
38 0.17
39 0.19
40 0.23
41 0.23
42 0.31
43 0.35
44 0.41
45 0.45
46 0.47
47 0.48
48 0.46
49 0.46
50 0.4
51 0.38
52 0.31
53 0.28
54 0.24
55 0.22
56 0.2
57 0.17
58 0.15
59 0.11
60 0.12
61 0.14
62 0.19
63 0.21
64 0.23
65 0.26
66 0.28
67 0.29
68 0.32
69 0.37
70 0.39
71 0.41
72 0.43
73 0.43
74 0.48
75 0.52
76 0.57
77 0.59
78 0.61
79 0.66
80 0.73
81 0.81
82 0.8
83 0.83
84 0.77
85 0.73