Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J093

Protein Details
Accession A0A397J093    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
65-92CGICLCFKIKYRKKSKKEKDETYSKETDHydrophilic
NLS Segment(s)
PositionSequence
76-81RKKSKK
Subcellular Location(s) plas 19, E.R. 5, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTFSFLILLVILFIQFPPSTLAYISTNRSSSWIFWSYEDGYRRCENICIMAFVISAVLLVALCACGICLCFKIKYRKKSKKEKDETYSKETDGNSMDEIYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.1
5 0.11
6 0.11
7 0.11
8 0.14
9 0.15
10 0.18
11 0.21
12 0.21
13 0.21
14 0.2
15 0.23
16 0.21
17 0.19
18 0.22
19 0.22
20 0.2
21 0.2
22 0.23
23 0.23
24 0.27
25 0.3
26 0.26
27 0.26
28 0.27
29 0.27
30 0.24
31 0.22
32 0.18
33 0.18
34 0.18
35 0.14
36 0.13
37 0.12
38 0.11
39 0.1
40 0.09
41 0.04
42 0.04
43 0.03
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.03
54 0.04
55 0.06
56 0.08
57 0.11
58 0.17
59 0.29
60 0.37
61 0.47
62 0.58
63 0.68
64 0.76
65 0.85
66 0.9
67 0.9
68 0.92
69 0.92
70 0.9
71 0.9
72 0.87
73 0.83
74 0.75
75 0.64
76 0.59
77 0.49
78 0.43
79 0.35
80 0.3
81 0.24