Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HU81

Protein Details
Accession A0A397HU81    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-40TKVKKFIVKLIKKIKEKNEKKSLKKERKLKTKEVMEBasic
NLS Segment(s)
PositionSequence
9-35KFIVKLIKKIKEKNEKKSLKKERKLKT
Subcellular Location(s) cyto 13, cyto_nucl 10.5, mito 8, nucl 6
Family & Domain DBs
Amino Acid Sequences MNFTTKVKKFIVKLIKKIKEKNEKKSLKKERKLKTKEVMEGVFELEKENNGATGFDYPRIFFLTKVVDGEVLFGDIVFGEPRDQEGMYVEFKGEGWNEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.74
4 0.79
5 0.8
6 0.8
7 0.81
8 0.82
9 0.82
10 0.82
11 0.83
12 0.86
13 0.87
14 0.87
15 0.88
16 0.87
17 0.86
18 0.87
19 0.86
20 0.83
21 0.81
22 0.77
23 0.72
24 0.67
25 0.58
26 0.48
27 0.41
28 0.34
29 0.24
30 0.17
31 0.13
32 0.09
33 0.08
34 0.07
35 0.06
36 0.06
37 0.05
38 0.06
39 0.05
40 0.09
41 0.09
42 0.11
43 0.12
44 0.11
45 0.12
46 0.15
47 0.15
48 0.11
49 0.13
50 0.14
51 0.15
52 0.15
53 0.15
54 0.13
55 0.12
56 0.13
57 0.11
58 0.08
59 0.07
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.08
69 0.09
70 0.09
71 0.09
72 0.12
73 0.14
74 0.15
75 0.15
76 0.14
77 0.13
78 0.13
79 0.15