Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J0S7

Protein Details
Accession A0A397J0S7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
245-270NRAQLSVIKHCKKKNKKSITPYISSCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, nucl 10, cyto_mito 8, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSLNRYSHFTPYYYSSSSVPSASVPSTSSVPSASFVPSAHTLSFASNTVSFIPPAANFYYSSYYYDPSHSYAAPCFVNSAYFTPSTYVSPASSTTLTTDSSTTFPASSTTLSASTTFSASSSITTASPAYITDTSFFSTTTYSSSITPSYASVFTYPTSTISPNFFATTYLNPTTTTSTNTNTISSTNHHTTSFAQAIPSSSRASSVAPDDSHTMTPPPAISRHDAMKSTLTSPDIEFYSPKVVNRAQLSVIKHCKKKNKKSITPYISSCLNDRGTGDHLEMAEDICKHYITSPPVSHYLWNHLSRAESIAFRRRTLESNLGMGFSYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.3
4 0.31
5 0.28
6 0.23
7 0.18
8 0.19
9 0.18
10 0.18
11 0.15
12 0.16
13 0.17
14 0.17
15 0.17
16 0.15
17 0.15
18 0.15
19 0.15
20 0.15
21 0.14
22 0.13
23 0.17
24 0.19
25 0.2
26 0.19
27 0.19
28 0.18
29 0.18
30 0.2
31 0.16
32 0.16
33 0.14
34 0.15
35 0.16
36 0.17
37 0.15
38 0.14
39 0.15
40 0.12
41 0.15
42 0.16
43 0.14
44 0.14
45 0.17
46 0.21
47 0.2
48 0.23
49 0.21
50 0.22
51 0.22
52 0.24
53 0.23
54 0.21
55 0.23
56 0.2
57 0.21
58 0.19
59 0.22
60 0.19
61 0.17
62 0.16
63 0.14
64 0.14
65 0.14
66 0.15
67 0.14
68 0.14
69 0.14
70 0.14
71 0.15
72 0.15
73 0.15
74 0.14
75 0.12
76 0.13
77 0.13
78 0.14
79 0.14
80 0.13
81 0.13
82 0.13
83 0.14
84 0.14
85 0.13
86 0.12
87 0.13
88 0.13
89 0.13
90 0.11
91 0.1
92 0.11
93 0.11
94 0.1
95 0.1
96 0.1
97 0.1
98 0.11
99 0.11
100 0.11
101 0.1
102 0.1
103 0.09
104 0.08
105 0.09
106 0.08
107 0.08
108 0.07
109 0.08
110 0.07
111 0.08
112 0.08
113 0.07
114 0.07
115 0.07
116 0.09
117 0.09
118 0.09
119 0.09
120 0.1
121 0.11
122 0.11
123 0.11
124 0.08
125 0.08
126 0.08
127 0.09
128 0.09
129 0.09
130 0.1
131 0.11
132 0.11
133 0.11
134 0.11
135 0.09
136 0.1
137 0.09
138 0.09
139 0.08
140 0.09
141 0.09
142 0.1
143 0.09
144 0.09
145 0.1
146 0.1
147 0.11
148 0.12
149 0.13
150 0.13
151 0.13
152 0.12
153 0.12
154 0.12
155 0.12
156 0.15
157 0.14
158 0.14
159 0.14
160 0.15
161 0.17
162 0.16
163 0.18
164 0.16
165 0.17
166 0.19
167 0.19
168 0.19
169 0.16
170 0.16
171 0.14
172 0.15
173 0.19
174 0.19
175 0.19
176 0.19
177 0.2
178 0.2
179 0.24
180 0.23
181 0.17
182 0.15
183 0.14
184 0.15
185 0.16
186 0.16
187 0.13
188 0.11
189 0.11
190 0.12
191 0.12
192 0.12
193 0.13
194 0.14
195 0.13
196 0.14
197 0.16
198 0.17
199 0.17
200 0.16
201 0.14
202 0.12
203 0.12
204 0.12
205 0.12
206 0.12
207 0.14
208 0.17
209 0.18
210 0.23
211 0.25
212 0.25
213 0.25
214 0.26
215 0.25
216 0.24
217 0.23
218 0.2
219 0.18
220 0.17
221 0.18
222 0.16
223 0.15
224 0.14
225 0.13
226 0.19
227 0.19
228 0.19
229 0.22
230 0.22
231 0.27
232 0.29
233 0.29
234 0.26
235 0.29
236 0.32
237 0.36
238 0.45
239 0.48
240 0.52
241 0.57
242 0.64
243 0.71
244 0.78
245 0.8
246 0.82
247 0.84
248 0.88
249 0.92
250 0.89
251 0.84
252 0.76
253 0.69
254 0.62
255 0.53
256 0.45
257 0.39
258 0.33
259 0.27
260 0.24
261 0.23
262 0.22
263 0.23
264 0.22
265 0.18
266 0.17
267 0.17
268 0.16
269 0.14
270 0.14
271 0.12
272 0.13
273 0.12
274 0.12
275 0.11
276 0.13
277 0.18
278 0.21
279 0.28
280 0.3
281 0.33
282 0.37
283 0.38
284 0.41
285 0.37
286 0.41
287 0.41
288 0.41
289 0.38
290 0.35
291 0.35
292 0.32
293 0.34
294 0.28
295 0.24
296 0.28
297 0.36
298 0.37
299 0.37
300 0.39
301 0.39
302 0.4
303 0.43
304 0.46
305 0.39
306 0.42
307 0.41
308 0.38