Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2LE90

Protein Details
Accession E2LE90    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-26RARRAIWEKKYGRNANHKKKEAABasic
NLS Segment(s)
PositionSequence
5-34ARRAIWEKKYGRNANHKKKEAAESGERGRK
92-114AKKKLKEKQGAAIVPPPPGRKIR
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037393  Bud22/SRFB1  
IPR015158  Bud22_dom  
KEGG mpr:MPER_04631  -  
Pfam View protein in Pfam  
PF09073  BUD22  
Amino Acid Sequences RGQRARRAIWEKKYGRNANHKKKEAAESGERGRKQWPSSANDGAASGNRGLSSSRSIKTSRSDGFGRQTDSAPHQHMANADRSQKLHPSWEAKKKLKEKQGAAIVPPPPGRKIRFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.75
3 0.78
4 0.8
5 0.81
6 0.85
7 0.81
8 0.75
9 0.72
10 0.72
11 0.66
12 0.61
13 0.56
14 0.52
15 0.54
16 0.57
17 0.52
18 0.46
19 0.44
20 0.43
21 0.38
22 0.38
23 0.37
24 0.34
25 0.4
26 0.42
27 0.38
28 0.33
29 0.32
30 0.26
31 0.21
32 0.17
33 0.11
34 0.08
35 0.07
36 0.07
37 0.07
38 0.08
39 0.12
40 0.14
41 0.15
42 0.17
43 0.18
44 0.2
45 0.23
46 0.27
47 0.24
48 0.24
49 0.25
50 0.25
51 0.3
52 0.3
53 0.3
54 0.26
55 0.25
56 0.23
57 0.25
58 0.26
59 0.23
60 0.21
61 0.19
62 0.19
63 0.2
64 0.21
65 0.23
66 0.23
67 0.24
68 0.25
69 0.27
70 0.28
71 0.3
72 0.3
73 0.29
74 0.3
75 0.36
76 0.43
77 0.51
78 0.59
79 0.61
80 0.69
81 0.73
82 0.77
83 0.78
84 0.78
85 0.73
86 0.72
87 0.74
88 0.67
89 0.61
90 0.58
91 0.5
92 0.47
93 0.47
94 0.4
95 0.36
96 0.4