Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397H318

Protein Details
Accession A0A397H318    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
10-36GSNEPIKCIKCKKRKPFNLSHLCRRCNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.666, nucl 11.5, mito 10.5, cyto_nucl 8.333, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
Amino Acid Sequences MTLISTKLDGSNEPIKCIKCKKRKPFNLSHLCRRCNAMNSQIVDSGNKNIDDFIKKTQFSTKLKFLIWVPYENFTNVKHIGKGGFSEIYKATWEKQIYKRNQKIFKTEMTEVVLKVLNDSQNVDTNNYFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.38
4 0.48
5 0.52
6 0.55
7 0.66
8 0.73
9 0.8
10 0.88
11 0.91
12 0.91
13 0.92
14 0.92
15 0.89
16 0.89
17 0.86
18 0.77
19 0.69
20 0.63
21 0.56
22 0.5
23 0.46
24 0.42
25 0.39
26 0.39
27 0.39
28 0.37
29 0.33
30 0.29
31 0.26
32 0.22
33 0.18
34 0.16
35 0.14
36 0.12
37 0.15
38 0.16
39 0.17
40 0.2
41 0.24
42 0.24
43 0.25
44 0.3
45 0.35
46 0.36
47 0.39
48 0.38
49 0.35
50 0.35
51 0.36
52 0.31
53 0.31
54 0.28
55 0.26
56 0.22
57 0.21
58 0.22
59 0.21
60 0.21
61 0.15
62 0.17
63 0.16
64 0.16
65 0.15
66 0.15
67 0.15
68 0.14
69 0.15
70 0.13
71 0.13
72 0.12
73 0.14
74 0.14
75 0.14
76 0.15
77 0.15
78 0.14
79 0.18
80 0.2
81 0.26
82 0.34
83 0.43
84 0.51
85 0.62
86 0.69
87 0.72
88 0.79
89 0.76
90 0.75
91 0.7
92 0.67
93 0.62
94 0.56
95 0.5
96 0.45
97 0.43
98 0.35
99 0.33
100 0.28
101 0.21
102 0.21
103 0.21
104 0.19
105 0.18
106 0.21
107 0.21
108 0.25
109 0.27
110 0.28